SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0289140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0289140
Domain Number 1 Region: 83-130
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000209
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 55-80
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000693
Family Somatomedin B domain 0.0044
Further Details:      
 
Weak hits

Sequence:  7227.FBpp0289140
Domain Number - Region: 299-329
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0785
Family EspA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0289140
Sequence length 395
Comment (Drosophila melanogaster)
Sequence
MSLLLLLLAVILPQRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCY
CDHACLKLGDCCDDFKDHCGVLDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQNGGKH
CPTLQQKRSCQGYRCHGHHDKKILREMALLLPAALTHNHHVNESGDLRHNLRTRYRDTYK
HNHDQEYCVEFEVIKSSKACNKLPPYNLMTEGDRITVRCDLEALIQDSAGSSTTARTPQG
PTTPSTTTVSSAASAFGQRTDDLEEERLQRETSSEEEATNQDGEAEEEDEEPEQDEQDDL
QNALDSDSNESTDYRHQRQSQMSQMSHSRRTAGKRSAVPATPSPTLPPTYHCRGEGLAGR
TTRWSALPAPSCRGKWLRLTVGPPKKCGHAQFIFV
Download sequence
Identical sequences Q9VZ43
FBpp0289140 NP_572674.3.81976 FBpp0289140 FBpp0289140 7227.FBpp0289140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]