SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0273566 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0273566
Domain Number 1 Region: 51-160
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.7e-16
Family Insect pheromone/odorant-binding proteins 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0273566
Sequence length 171
Comment (Drosophila pseudoobscura)
Sequence
MMPPMLAMTSSLLLMLLLLQMDCVRGQGFDLTKILVSRGTEPIWTVMVRQLPHVQDMIDT
GRRECIKELKLPKDQRPLMRVSNPSEKEKCLIECVLKKTKIMDDKNKLNLAQVEKLTGLV
TQDNKMAIALSCSLAQTCNRSISAKNPCEAAHQLNQCISRQLERNNVKLIW
Download sequence
Identical sequences Q29IH3
FBpp0273566 7237.FBpp0273566 XP_001355621.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]