SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0275718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0275718
Domain Number 1 Region: 508-870
Classification Level Classification E-value
Superfamily Arginase/deacetylase 5.28e-113
Family Histone deacetylase, HDAC 0.000000938
Further Details:      
 
Domain Number 2 Region: 78-435
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.21e-105
Family Histone deacetylase, HDAC 0.0000028
Further Details:      
 
Domain Number 3 Region: 955-1050
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-21
Family Zf-UBP 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0275718
Sequence length 1095
Comment (Drosophila pseudoobscura)
Sequence
MAMKSGSNSTAAAASSSTSGAIKSSSVGAELPKRSETLLEAKRRARNMLKNQGNTPAMQE
TVTDIFQTAVKSRPLVRGETALVYHQSMEQHCCRWDPKHLECPDRFNRVLDRCNELKLLD
RCLPVSARLATKQEILRLHTAQHFELLEQTSEVCDDQSMEELSSRFDSIYIHPSTFQCSL
LASGSTIDLVDSIITGKAQNGMAIIRPPGHHAMKAEFNGYCFFNNVALAAQHALDVHKLE
RILILDYDVHHGQGTQRFFYNDPRVLYFSIHRFEHGAFWPHLQESDYHAIGEGPGLGFNF
NVPLNETGMGDGDYMAIFQQLLLPVAMEYQPELIIVSAGYDAALGCPEGEMQVTPAFYAH
LLNPLLRLADSRVAVVLEGGYCLESLAEGAALTMRTLLGDPCPMLVEPLLPPKRSMSKSI
LNCIFAHRPYWRCLQLQGTYDPSELKTKDRSRELHVVERAWVGGPPPVTVYPTRDTSVQH
LIPEAVVADNTARLHRLRLETILTVPAVRVCYAYNPEMMEHRNLDDLGHPEQPKRIQFIH
KMHQDYQLLGRMKQLSARAATTDEICLAHSRSHVNTMRRVLGRDKEDLQAQAATYNSVYL
HPATFGCATLAAGSVLQAVDSVLRGESRSAICNVRPPGHHAEPDQPHGFCIFNNVAIAAQ
YAIREFGLKRVLILDWDVHHGNGTQHIFESNPKVLYISVHRYENGTFFPKGPDGNYDVVG
KHTGAGFNVNIPWNKKGMGDLEYALAFQQIVMPIAYEFQPELVLVSAGFDAAIGDPLGGC
KVSPEGYGLFTHWLSALAGGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPLLGVVA
LTRPPTTAFQSCLETLQCCVEVQRQYWKSLEFVGYRLPHGYQIGENNNEDFLAASLLKLN
ISSDDAQGAAGGPTDGDQADPGQERPSDSKPKVKVKPPNHSTAAPEEMFAIPPSKTCPHM
RMLRPELVPQSINTRAPCGECISRSENWMCLSCHYIGCGRYVGRHMQRHCEALEHTLVMR
LQDHAVWCYVCGVYLDNPRLFEYKNRAHQDKYGRPLAWRYPCAKRADGCYPLDPESDSEE
EADHIANGSYLQEAQ
Download sequence
Identical sequences FBpp0275718 7237.FBpp0275718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]