SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0277246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0277246
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-82
Family SSRP1-like 0.00000486
Further Details:      
 
Domain Number 2 Region: 548-624
Classification Level Classification E-value
Superfamily HMG-box 1.57e-23
Family HMG-box 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0277246
Sequence length 727
Comment (Drosophila pseudoobscura)
Sequence
MTDSLEYNDINAEVRGVLSSGRLKLTDQNIIFKNNKTGKVEQISVDDIDLINSQKFVGTW
GLRVFTKSGALHRFTGFRDSEHEKLGKFIKDAYSQEMVEKEMCVKGWNWGTARFMGSVLS
FDKDSKTIFEVPLSHVSQCVTGKNEVTLEYHQNDDAPVGLLEMRFHIPAVESADDDPVEK
FHQNVMSKASVISASGESIAIFREIQILTPRGRYDIKIFSTFFQLHGKTFDYKIPMDSVL
RLFMLPHKDSRQMFFVLSLDPPIKQGQTRYHYLVLLFAPDEETTIELPFSEAELRDKYEG
KLEKELSGPVYEVMGKVMKVLIGRKITGPGNFIGHSGTAAVGCSFKAAAGYLYPLERGFI
YIHKPPLHIRFEEISSVNFARSGGSTRSFDFEVTLKNGTVHIFSSIEKEEYAKLFDFITQ
KKLHVSNMGKDKSGYKDVDFGDSDNENEPDAYLARLKAEAREKEEEDDDGDDSDEESTDE
DFKPNENESDVAEEYDSNVEDDSDDDSDASGGGGDGGTDGSTKKKHKEKKNEKKEKTHKE
KEKIKKPTKKKDTGKPKRGTSAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKELKDK
SKWEEAANKDKIRYQEEMRNYKSGAGGGSEDEKGGTSKATKKRKSEPSPSKKANTSGSGF
KSKEYISDDESTSDDQEKVKEIPKKKNKSTAEDKDKNSKKSESEGGDSDDASNASEDDDE
EEDEGSD
Download sequence
Identical sequences B4GBL1 Q293F6
XP_001357531.2.19638 XP_002015416.1.64850 7237.FBpp0277246 FBpp0277246 FBpp0175178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]