SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0277357 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0277357
Domain Number 1 Region: 572-632
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000377
Family PHD domain 0.0034
Further Details:      
 
Domain Number 2 Region: 251-304
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000664
Family PHD domain 0.0068
Further Details:      
 
Domain Number 3 Region: 646-714
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000377
Family PHD domain 0.0083
Further Details:      
 
Domain Number 4 Region: 523-581
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000131
Family PHD domain 0.018
Further Details:      
 
Domain Number 5 Region: 198-251
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000146
Family PHD domain 0.023
Further Details:      
 
Domain Number 6 Region: 331-398
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000443
Family PHD domain 0.014
Further Details:      
 
Domain Number 7 Region: 1180-1227
Classification Level Classification E-value
Superfamily HMG-box 0.0000209
Family HMG-box 0.0058
Further Details:      
 
Weak hits

Sequence:  7237.FBpp0277357
Domain Number - Region: 1267-1381
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.0353
Family Myeloperoxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0277357
Sequence length 1486
Comment (Drosophila pseudoobscura)
Sequence
MNTNVVVNAEEKPAVGDELPYSPEQFPGKVCCLCNLGERSALGQGTILQLKAPADIKDEY
PPDRLTEDGSRSYYGSKQEAACTAESNYELDKIGQAEVVHPSKFLDEGFVYVHRMCVMWS
LRKSQIADSDAAYFVNHIGEFLKQKCNFCGRYGASINCKMNCRQVHHWPCAAAAGCLLIL
ESFTVFCTEHLSQVPLICSDNNVECLSCSSLGDLSKLIMCSTCGDHFHSTCIGLANLPDT
RSGWNCARCTKCQICRQQDSNDLKYVKCEQCQKIYHASCFRPVISAIPKYGWKCNRCRVC
TDCGSRTPGGGSSSRWHSHYTICDSCYQQRNKGFSCPICQKAYRAASHKEMVKCSWCHKF
VHSTCDEEADLTAYHKKKEQNPDYDYICPNCKQNSSGPAQPQQLIDSIVLTTMDSSAEQL
SVKDLELVDPLESKPIADVSTDDVQKMPPTGKKKMCLSNVRGKSGKFLHRMGVLSQINKK
RSTRGKGRTIVLPNLTSDRYANRNMDADLTSDKKMVLCSTRDKFTLNQDICVMCGSLGIE
SDSVMITCAQCGQCYHSYCASVKPSKGILQKGWRCLDCTVCEGCGKKNDEARLLLCDECD
ISYHIYCVNPPLETVPSGNWKCSFCTLCQKCGLNPTEKSDYGDSNMPECPSCTSQSSCSV
CRNPYSTGEMIIQCETCELWSHFLCDSINVQLTIEYYDQNVYKCLKCRCAGKPPLSLNDG
KPGSSTQTQTNKVSAHPGSGAGGAEGKNASGSDQGQMTLSSDLVESTPEAIHWIDNVCLS
ENGLTMIKSLSTEIKRKRKMRQTIGNGKDSQGDAATAEETQSEKYKDGMVWDGTENPIPE
GFTITTNDEGVHILRKKRQRNLQKLGIGGFSVRNRALKKDSEDTPVADQLNAIMVMDKKK
KIIRKKQKNKLIEAYPPYLQEAFFGKPLLESGELVLGESDSSDEIDASMKMYFTRVEGIS
PDQEASLVNKSPAKSLKKVKAEKNQPESKNALTEQISIGPGLQPKTANGSTANVFDPSQS
DLSNTVLASRNPLDSLASPNISELDGMNTSVNSVTSSENMEKPMRESPVVLVDNYAMPQQ
IVPDQKFHNQIYLPGNVVANPAQQLHYHSQPDLLSAKNANKQKMQSMMAQVCLQTEKRVE
EEPKPVEPVTESLNAGTQKTAEKMRKDEDLGLMATISAVLYANTEHPNLKDLFPNWNDRC
KQILKRWRSLCNEKKAPFLQKAKDNRSALRQRREQNKIPLPTKPQKQEDIGRAWKQQSKV
KEEQSNMFVTYNGNTYDSCYVGGPPPATVNPHLATPSLNENHVVKAPMQRAIIHVSPAST
SNTVKMSTVDNRLDLNSVYGPEPIGDKKLRNLLQKNSSESMLIGTNSELFLQNDVLRLGM
MSNTPLTQNNPMLSVTGKAPPTDGRSLDQDVKMNESQEGTASAVELENVGFGDLLGGLGE
GDDDDLLKSLTSEIGDDFNILEYADPELDVNVLNTLDFDDNEKCSA
Download sequence
Identical sequences Q292Q5
XP_001360232.2.19638 XP_015039138.1.19638 FBpp0277357 7237.FBpp0277357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]