SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0278838 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0278838
Domain Number 1 Region: 277-405
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-33
Family Synaptotagmin-like (S variant) 0.00083
Further Details:      
 
Domain Number 2 Region: 413-533
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.06e-30
Family Synaptotagmin-like (S variant) 0.00059
Further Details:      
 
Domain Number 3 Region: 21-67
Classification Level Classification E-value
Superfamily HMG-box 0.00000367
Family HMG-box 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0278838
Sequence length 569
Comment (Drosophila pseudoobscura)
Sequence
MGCSSKPQKKYRAQKVGPVTKNGYLNYLRVFKKKHCGLSPREMIRKGAKAWNALSCEQKA
SFRKKTKSGRRSRGKKSTAMDILIREEDISLAQIGVYASVSFLVVSAVGAALYTTCSRRY
RLNWFEQNLLESANEKDEDQQREALVAGAAGYNVDNLNECSRGNLSPTSLKNDENDPAFW
VPASVASTAAIQQQVSNTTEESAPPTPTSPTGSLKSNTLSLCSTASVPIARSDKHVVLAM
HPTRPRVSSMNAKLDHTKIDMTLYRSHAQPKTLDPAPAIEVRGNLHVGISYDPVGGLLNV
RLLEAQNLQPRQFSGSADPYAKVRLLPDKKNFWQTRIHKKTLNPVFDEHFVFEVAAGVID
KRTVEILLYDFDAYSRHVCIGGTKLHLANIDLSEQLQLWTPLSSASAQDMKVDLGDIMVS
LAYLPSAERLMVVLIKARNLRIVDDARNSSDPYVKVTLLGPVGKKMKKRKTGVQRSTVNP
VYNEALAFDVNKETLKNCVLEFTVVHDGLLGSSEILGRTLIGNSSEVRTEEKIFFEEMFR
AKNATAQWVPLQEPATNLANAAKSTTNKN
Download sequence
Identical sequences 7237.FBpp0278838 FBpp0278838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]