SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0282879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0282879
Domain Number 1 Region: 456-652,725-1055
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-74
Family Tandem AAA-ATPase domain 0.085
Further Details:      
 
Domain Number 2 Region: 285-360
Classification Level Classification E-value
Superfamily UBC-like 0.000000193
Family RWD domain 0.08
Further Details:      
 
Domain Number 3 Region: 249-272
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000235
Family CCCH zinc finger 0.0019
Further Details:      
 
Weak hits

Sequence:  7237.FBpp0282879
Domain Number - Region: 120-159
Classification Level Classification E-value
Superfamily UBA-like 0.000994
Family UBA domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0282879
Sequence length 1289
Comment (Drosophila pseudoobscura)
Sequence
MDESSRQHMEDFCFMRAPSDVRTTNVPVAPPRTVADNKSRKTELHVVRLSDEAKQMTMDT
LRTIHGPDFKLEDISKYKDRGRGGHGVKHAYWQDRGTLMVQSVQGVSSTRGDSNDEDRIR
RYALLKLECYGFHPAHCLEAYEHCNNDTEAALLLLYKRYMRVPEQEKLNLEPPSEAELLD
MRSDEKEALESIYDRAYEERESNRVWNLKFKIDHLLAHSPSEVRKAREAAAAAAAASAQA
ALDKKKKAPQRCRNFERDGTCKYGPKCRFAHVPAQPVLPSTPKKENLDENDNELWFHVEV
RFPPGSHYPYEAPFIYLKTTCHDIPHELRLRYARHLYREAREICRDGIPCVYSICDLLQS
SEDLAGRLDTARFPSPKRSLFYNEPETGEAMDNGVGEQTVKPSHYARGQTSRNEGAYQRN
TEAQARENRRLLQQFVERRKDERYQKVIEGRRQLPAFAEIESILALIESSPVVVISGETG
CGKSTQVPQFILDNWFFRALQLQPKETLPHVEIICTQPRRLSAIGVAERVAAERLDRIGQ
LVGYQIRLENKVSQSTRLSFCTTGILLRRLASDPMLAGVSHVIVDEVHERSEESDFLLLI
LKNILRERKDLKVILMSATLNASLFSNYFGGAPVLDIPGRTFPVQQLFLEDILELSDFVM
EYDTKFCRKLKKSEQDVLQRELEYADVQAAGPPPGKKIKDEKLTLAETYSRYAEYSKTTC
KSIYLMEPMTINPELIESVLKYIVEGAHEWPRTGTILIFLPGMHEIQTVHDALLDHSLFS
PRAGKFVLVPLHSALSGEDQALVFKRAPAGKRKIVLSTNIAETSVTIDDCVFVVDCGLMK
EKCFDSNRNMESLDLVWVSRANAKQRKGRAGRVMPGVCIHLYTSHRFHQHILGQPVPEIQ
RVPLEQIVLRIKTLETFASRNTLSVLLETLEAPSEDSVLGALTRLRDVGALDADDQLTPL
GHHLAALPVDVRIGKLMLYGAIFQCLDSVLTIAACLSNKSPFVSPLNKRVEADKCKRLFA
LGNSDHLTVLQAYRKWLEVARRGNYAASRNYASEHFLSLNTLETIADLKYQYLELLVSIG
FVPIDVPRRRKNASDNILQLTGADQNHNGDNNRLLTSLLCAALYPNIVKIMTPERVYVQT
AGGAVPREQGHHDLRFKTRGDGYVKIHPSSVNSQVATFQSPFLVYQEKVRTSAIYIRDCS
MLPLIALVLFAGSDFKVELHDGDFLFLLETGWIILKAHDHETAEMVQCLRSELIKLLEEK
IRDPCLNLLHHKNGCRMIANIVHLLSKNS
Download sequence
Identical sequences Q29HF5
7237.FBpp0282879 FBpp0282879 XP_001354748.2.19638 XP_015041639.1.19638 XP_015041640.1.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]