SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0287603 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0287603
Domain Number 1 Region: 1590-1864
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-42
Family Kelch motif 0.013
Further Details:      
 
Domain Number 2 Region: 366-632
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-27
Family Kelch motif 0.019
Further Details:      
 
Domain Number 3 Region: 29-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-22
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 1312-1360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000854
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 211-270
Classification Level Classification E-value
Superfamily Kelch motif 0.000000432
Family Kelch motif 0.024
Further Details:      
 
Domain Number 6 Region: 1189-1224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000503
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 2303-2352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000377
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1379-1492
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000419
Family Spermadhesin, CUB domain 0.0065
Further Details:      
 
Domain Number 9 Region: 2356-2429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family Laminin-type module 0.046
Further Details:      
 
Weak hits

Sequence:  7237.FBpp0287603
Domain Number - Region: 1265-1312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000226
Family Laminin-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0287603
Sequence length 2884
Comment (Drosophila pseudoobscura)
Sequence
MYALLATLTFWIITLRSPLQSQQLHIPPPAPCDRSRKVFTEPYGEISDGPSGFNYTQDSH
CEWLIKAKNDSQFITLTFHSMGTECSYDYIYVYDGDSFNSTLLGSFSGRTQPQRLVARSG
SMLILMYSDTNYVLDGFRASYYISNCLNNCHNHGKCIGHQCVCHGEWVGPDCEDEACPQK
CGESQGRGKCQKSICHCSPGYSGRLCDLSDNPHGNSWRWLATDAEGMTPRAAHTAVYIEE
EDALFVFGGYDLNNVISTLQIYRFSTSQWEDEWGIALQSRRHFYHPQKIDHTLLKAVLQH
KNEDEAKLWGLNSDVSFFRNILYTLAESNLHQRRTRSSLPLTIVNANSTDEELNEYLEDI
LEVVTDHKPHGRYGHAADRVPGGFVIFGGKHANGSFYSDLWQYNNTESGGKWKQMAIRSK
IKPPAVARHTLNTARDHLYMFGGSLETGEFSSSVYRIALPLSEDSQWELVKPRGGKTLDV
RLAAHSTVYYRATHSLIVFGGIMTSLARFSKLSDRIFAFQLDQMHWTEILYPRTALRDTN
IPRERAFHTATISGNYMIVFGGYTHRHNKDEICYDNQMYWYHLSCHIWINQVVSAEDSLY
PKAQGVFAQAAALRRNHTLLIVGGYHGNVNADLFAYELPQVLRVENTLYNPEVSCRLHPS
HTACLSNPECGWCSADSSCYGRTIGANCTTNLQTTRCPGICPSLGDCHSCLVHGSKWGKQ
GSGGGKAFSVTSKLGLNECTWCVQNAKCHHRDDNYGICGESTGWWGDQGTEIRTPTLCTI
NDRRPGLTYIKYHYPINFTMPDYVGIVNATMVDFSSPPFTTHFEQKLEGEMLARLVGFVR
PKQQWNNSAIQVCSSYSSSLLRFGLGLNLDELVNVTSQSSNQSYCSNVPLPTTEMPFLID
FQARRRIGLNSIYNTYQKTKMELQHLHGGQLNAFTFEYLEPYYSGHCTKYENCLHCLTDA
SCSWCPLTAKCHLRSVNESAVCTDPKDTSHWSYLISKPTQCSNCTNFVSCEACASSGLCE
WWTEDARCGRIGKSNSSVRAVEQCPRSCRERKGCQECLSERGRCVWCEASAQCFSFAVYT
SEYQFGMCREWMDQVVPRQQEKAAATTDEQQQQQQPLPPLQQQCKSCEQHRNCSACLRTL
SCGWCFDRDNPIEGICMQGDFSYSAGNCSLALNSSSHHDAEWAYAQCPDVDECGLGLHDC
HKEAKCTNTQGSYNCHCRRGYVGDGRFSCVRTCFELCQNGFCSGPPDYSCRCDLGWTGSD
CGLSCGCNNHSTCAERLGKCDQCQAWTEGERCERCRQGSHGNATAPQGCHPCECNGHGNQ
DLGICNVSNGECYCKDNTQGLKCDSCAPGYYGDPRDGGQCYYQCESRGILSNIGRSAIGS
YQAYRSPWGASLEVKECLWILQPKTLQAEKSLLQLEFQWQSLAMDCDENAVYIYDSLPDL
TGATQQNQLLAVVCAPYSSARIIEARSSHVTVHYKQAGDHRHFGFNALYSVKNCVAGSCL
PPHICDSQMRCVCPAGYVGARCEIEVCPSNCNAKRGQGYCDTEYGRCICSNVNYAGADCS
TLVQPHHLVLTELFNTQLLSESQEHLRKTIPRFGHSVSADRRGSLWMFGGYSPNHGPLND
FRQFDIKNGTWLQVTVESSTPEDSMPLGRYFHASEIYVKRQIIYIYGGIGVNTRLLDDFW
MFSIQNQRWSQIKVEVDSKDVETPEPPPRLAGHTLTHVRYQEHESLLLVGGLTLNKSRPL
ELWEYSLDTGRWQKLEAMGARMPVLYGHSAVYHAETQSLYLFGGYASQPQSNLYALDLQK
LSWTELPSFKELNAPATNLPRARYFHSAVSTEHYMIVYGGRTIPYNATDVLIAYVYSCNQ
WVRLTEDVELIGRVPASNYAEDMAIDPDTGVIFVIGGWDGSATHSHVTRIALPEDICQLW
SSGKYLCRHYMGCSYCTVQNTYSFSSHCFSQGRTPCANHNGTLVVNNGAACTDAWMASRN
CSSFGSCSACLAAWPTHHEVTPVCQWCDQCGIQGRCVPAGVDCWRSAWCGNDQSVAVLGL
CPLPQCYWLNCESCLLQPQCQWARNELGSVECISKELVEKNQYRVIDRCAPPCHSHENCS
SCLTNTDQDQKDCKWSTMLGQCLSPSSQPLLCAGGVCGLVLESAELDRCPEPCHVYQQCS
SCLEHAHCGWCAREGLNGDGICTEGALESKQEHPSGSTCDLIYSTWRNDSHLTHADVVSW
HYIHCPAENECTNGHHNCHAISEQCIDLDTPLGYKCVCAQGYREEQGTCLPVCSQGCVRG
KCVSPDECQCDFGYVGANCSIQCLCNGHSNCESSSLLDNCLKCHNNTMGEQCEKCQPLFV
GNPREGHSCQPCLEYCHGHSDVCVAYDSDPTVFNMSRSDLDRILLEGPAHNATCLRCGNH
TAGDRCDSCLTGYFRGSEDLHKECRPCQCHGHGSICDPVTGEKCNCANNTESDATCTAGG
GKNSAQLCWSVQCSKCRDSYAGNPIDGHQCYKQITVESRMCFDAKPIEECKSKPAALKPG
QTVFFVIQPRFMNVDIRIIIDVTQGELDVFMSPQDDSFIVETNETTGYHEIFLDNRYNWG
PKQQRDRPLNVALPRHDNVTIQKLFTPERRIYADKDGLGGGMSMNSYYVPQLHDCKSHGG
HNFIVKDQHAKDLSTHVTLNHCNTLLRLFGLRNRLVLTLPQHAHNLSATRFFIALRANAG
PEPSYGSVVFRQDQLHIDLFVFFSVFFSCFFLFLAVCVIVWKVKQTADLRRARRQHVVEM
LHLAKRPFAQIFLASNSLDTESPRASTSTRAMRQRARQALLLQEQASTGDPIPPRYTRHR
HARDIMMVAIEPTSDNQAAVGTVFVSLPGRSRAPLSIALGSTLITYSRQYMRAQRAHHVA
HHPA
Download sequence
Identical sequences FBpp0287603 7237.FBpp0287603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]