SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0226279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0226279
Domain Number 1 Region: 166-474
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.18e-40
Family NodB-like polysaccharide deacetylase 0.011
Further Details:      
 
Domain Number 2 Region: 63-105
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000123
Family Tachycitin 0.015
Further Details:      
 
Domain Number 3 Region: 120-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0226279
Sequence length 539
Comment (Drosophila virilis)
Sequence
MAKLFVVFAVLALAAIGAANAEEVRVKRQATTEEPKKEESFEKELCKDKDAGEWFRLVAG
EGDNCRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKESVKNCKSKNKERRVKPLLHTDE
PLCQDGFLACGDGNCIERGLFCNGEKDCSDGSDENTCDIDNDPNRAPPCDPAVCVLPDCF
CSEDGTSIPGDLPAKDVPMMITITFDDAINNNNIELYKEIFKGRKNPNGCDIKATYFVSH
KYTNYSAVQETSRKGHEIAVHSITHNDEERFWSNATVDDWAKEMAGMRIIIEKYANITDN
SVVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNLQS
CPTRSHAVWEMVMNELDRREDPANDEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHYDQ
NRAPLGLYFHAAWLKNNPEFLDAFLYWIDEILANHNDVYFVTMTQVIQWMQNPRTISEVK
NFEPWRERCVVEGRQACWVPNTCKLTSKEVPGETINLQTCVRCPNNYPWVNDPTGDGFF
Download sequence
Identical sequences B4LD22
7244.FBpp0226279 XP_002047561.1.90633 FBpp0226279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]