SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0229499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0229499
Domain Number 1 Region: 87-141
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000942
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0229499
Sequence length 212
Comment (Drosophila virilis)
Sequence
MLSKYQQLLLVIVGLCLSVAHADVDCSQRPKFVNPMTCCPMPEFVTAELKEKCQQYNITP
PSPPPMSTEQQSGEGRRPHPHHHFLPPCFVSCVFNETGIYEDNSLDADKLKDYLSIVFKD
SEDLQTVASDAFTTCAAKVDERQDKMGNRPRPSPPPGMPLCPHKPAFLLGCVFKNMMKNC
PASVWTDTQECNETREFFKSCKPPHRRQATAA
Download sequence
Identical sequences B4MFN8
7244.FBpp0229499 XP_002059872.1.90633 FBpp0229499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]