SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0229876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0229876
Domain Number 1 Region: 55-116
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000785
Family Tachycitin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0229876
Sequence length 138
Comment (Drosophila virilis)
Sequence
MCSSTKMVYSYRILWLSGVFLAPLLLVATDAQEPASPVFQNHKTKEWTNLDNITFSFDCK
RRSVGFYADMEYNCQIFHMCDEEGNRIPHLCANETSFNQEYRICDWDYNFNCTESPKWFY
LNELTYATDPPDEDDEDY
Download sequence
Identical sequences B4MG23
7244.FBpp0229876 FBpp0229876 XP_002060073.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]