SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0229880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0229880
Domain Number 1 Region: 84-152
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000497
Family Antifungal peptide scarabaecin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0229880
Sequence length 819
Comment (Drosophila virilis)
Sequence
MWKFVCLMLLLATGCSAGPLAQQQRKNMPIVAREDSAPAVQESDMEAEAEPEMTASGSAA
EAAPLAGTLTLPSNATSIRADITDNFSCANKSYGYYADVENDCQIFHVCLPVTYADGKEN
TFRWSFICPEETIFSQESFTCMRREDMTIECEDSSRYYELNGNFGLPMEEEKENANKPGA
AAATESEEPDQPEESEVPAPSEPAAAVATPEPAKPVKVQKPKPKPNRRKPAVTYNKPAVV
YNKPQRKAPVVATAAPVVEPIVESEPEVVIVPVQQASKHPKPQRFSVRPNKDKPKPVVPA
TAAPVRNELFNAIRKRPAIFNKNSVSSTAKPVQEATEASVTEEVVQAELNEPQPTLKLQT
IFVEPVAQASEPVVAIAQPELDAEPEPEEPEAEPEQTKLKEPMEEASPMPEQMLEMKPIE
AIPEIPAVIVESLAEKPQEIENKPQMEVVAEDSAMEPAIMEPSGSGEESLNNIEALEAAK
PADAPVSLPATPEMANPSPLVEEMLDNNSEVQESLGGFKPVDPAMAAEAEQLITDFLNTL
RKHEKKTETELANAAMDIAETVEQQQPQNQEIDSNPAIEETEAVSIEEAKLPEPDKVDPI
ASVEEQLLETETKQKQKPDSPIINIMQLNHLPADYQIPVQVVAAPEPEPEAAEESAKETE
VKEAIQDDAQESLASAAYMPGISIDDIVELVKERLDQNPKNEQLTPMELVLTPGAAAPMT
LIESTAEQKPEREQSAPAAALIVEPAPAAAEEDGPILPIYKRVSVADPAMSAAQTQPVTV
SKVEGEATPQQEVIEVREPKSQTRMDARKRRFLFRADAS
Download sequence
Identical sequences FBpp0229880 7244.FBpp0229880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]