SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0230002 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7244.FBpp0230002
Domain Number - Region: 21-91
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00325
Family Calponin-homology domain, CH-domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0230002
Sequence length 336
Comment (Drosophila virilis)
Sequence
MPKQSSSVKRTSLSAVEQYELNQWLEENRINSSNLRRSFTDVLPLARLMSRYYPEMIDLN
YYPPRNSVQNKLCNWESFNKRVLARLGLQLTRDQMVRVARSVPGSVDLLLYSVMRVQMAA
ERKAREERPSSEDEDIDADEKQSAGEPDDKKADKARVKPMGVGMDTVNRNLKQTPASPLK
RAAAAAVSVKAAAVAGAARGGGGGGASTGRNKRQQLTMSGASSRELSHPQRQRGEQLCEL
PKQRMVLYSIYMQAVNQLQRKNAKIERFNQWSAHLENMLQLKCERIDELQRQVAVAALSS
RHKPLRMGHRRARLKKRNMQLANTIGGMLKLAVKRL
Download sequence
Identical sequences FBpp0230002 7244.FBpp0230002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]