SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0230815 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0230815
Domain Number 1 Region: 457-655,728-1058
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-74
Family Tandem AAA-ATPase domain 0.073
Further Details:      
 
Domain Number 2 Region: 286-359
Classification Level Classification E-value
Superfamily UBC-like 0.00000906
Family UBC-related 0.092
Further Details:      
 
Domain Number 3 Region: 246-270
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000484
Family CCCH zinc finger 0.0023
Further Details:      
 
Weak hits

Sequence:  7244.FBpp0230815
Domain Number - Region: 116-162
Classification Level Classification E-value
Superfamily UBA-like 0.00339
Family UBA domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0230815
Sequence length 1292
Comment (Drosophila virilis)
Sequence
MDESSRQRIEDWHLRPPSDARTTNVPAAPKSAPDNKSRKTELHVLRLSDESQQLTMDTLR
AIHGPDFKLDDIGKYKDRGRGGKGIKHAYWEDRGTLQVQSVQGVSGPSSTADDDRLRRYA
LLKLENYGFHPVHCLEAYEHCSHDTEAALLLLYRRYMRVPSDETPELEPPDESALLDMRA
DEKEALQSIYDRAYEEREYNSVWNLKFKIEHLLAHSPSEVRKAREAALAATAAARQAALD
KKKKAPQRCRNFDRDGTCKFGPKCRFAHVPPQPEVSGTPERKRAENLDENENELWFHVEV
RFPPGSRYPYEAPYIYLKTTCHDIPHELRLRFARHLYREAREICRDGIPCVYSVCELLQT
DEGLAGSLDTARFPSPKRSLFFDEPANGADLLDANGAAASAPRPSHYERGQTARSDGGAH
QRNATELARENRRLLQLFNERRRDERYHKLIEARRKLPAFAEMERILALIDSNQVVVISG
ETGCGKSTQVPQFILDNWFFRATQLPPKSDLPHVEILCTQPRRLSAIGVAERVAAERLDR
IGQLVGYQIRLENKISPSTRLSFCTTGILLRRLASDPLLSNVSHVIVDEVHERSQDSDFL
LLILKNILRERKDLKVILMSATLNATLFSDYFGGAPVLDIPGRTFPVQQLFLEDILDCCD
FVMECDTKYCRKLKKKEQDVLEQLLEFADIQASGEPPGQKVKDENLTLAETYSRYADYRK
TTCKSIYLMEPMMINPELIESVLKHIVEGEHEWPREGSILIFLPGFQEIQTVHNALLDSA
MFAPRAGKFVLVPLHSALSSEDQALVFKRAPPGKRKIVLSTNIAETSVTIDDCVFVIDCG
LMKEKGFDSNRNMESLDLVWVSRANAKQRKGRAGRVMPGVCIHLYTSFRYQHHILAQPVP
EIQRVPLEQIVLRIKTLQTFASRNTLAVLLETLEAPKEDSVLGALMRLRDVGALDAEDQL
TPLGHHLSALPVDVRIGKLMLYGAIFQCLDSVLTIAACLSNKSPFVSPLNKRVEADKRKR
QFALDHSDHLTVLNAYRKWLAVAKRGHYGASRNYASENFLSINTLETIADLKYQYLELLV
SIGFVPINVPRKRPNSSDNILQLTGHEQNVNGENNRLLTSLLCAALYPNIVKIMTPDRIY
IQTAGGAVPREPGHQDLRFKTRGDGYVRIHPSSVNSQVAVFQAPFLVYQEKVCTSSIYIR
DCSMLPLIALVLFAGSDFKVELHDGDFLFLLESGWIILKAHNHETAELVQCLRTELIKLL
EEKIRDPCLNLLHHKNGCKIIANITHLISNNY
Download sequence
Identical sequences B4M7R5
XP_002057346.1.90633 7244.FBpp0230815 FBpp0230815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]