SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0231468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0231468
Domain Number 1 Region: 112-469
Classification Level Classification E-value
Superfamily Arginase/deacetylase 4.75e-103
Family Histone deacetylase, HDAC 0.0000022
Further Details:      
 
Domain Number 2 Region: 540-886
Classification Level Classification E-value
Superfamily Arginase/deacetylase 4.8e-103
Family Histone deacetylase, HDAC 0.00000163
Further Details:      
 
Domain Number 3 Region: 975-1072
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-24
Family Zf-UBP 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0231468
Sequence length 1138
Comment (Drosophila virilis)
Sequence
MSSPIVTRRGAQQAKIQTRAMVKSKSTSTSSSSATAAAAAAAAAANAATGPNANSSNGAG
SCGPRKPSPALQEAKRRARNMLKSQNNGTAAQLEPVIDIFQNALNAKSMHRGPTALIYDE
TMSEHCCLWDSTHQERPERFTRTLERCRELKLVERCLQLNSRLATKDEILKLHSMEHYER
LEQTSAVHDAEAMEELSSHYDAIYIHPSTFRLSLLASGSTIELVEQLLLGKAQNGMAIIR
PPGHHAMKSEFNGYCYFNNVALAAQHALDAHQLQRILIIDYDVHHGQGTQRFFYNDSRVL
YFSIHRYEHGSFWPNLQESDYHAIGAGSGTGYNFNVPLNAKGLGNGDYMAIFQQLLLPVA
MEYQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLHLANCRVAVVLEGGYCVESL
SEGAALTLRALLGDPCPALVEPLQLPSPVLREALLNCIYVHRPYWRCLQLQQTYTPGELQ
SASTIPLHRVQRIWLGGPPPAPDQRYPTRGTSAQLSAAVVASNASRLSLLRAETQLSVPP
VRVCYAYDAQMLQHFNLHDATHPEQPMRIRQIHQMHEDYQLLDRMQQLAARAATTDEVCL
AHTRAHVNSVRRLLGRSVEELQQVGAGYNSVYLHPRTFECAILASGAVLQAVDSVLRGQS
RSGICNVRPPGHHAEPDQPHGFCIFNNRILIVDWDVHHGNGTQHIFESNPKVLYISVHRY
EHGAFFPKGPAGNYDVVGKNAGRGFNVNIPWNKKGMGDLEYALAFQQLILPIAYEFNPQL
VLVSAGFDAAIGDPLGGCKVTPEGYGLFTHWLSALAGGRIIVCLEGGYNVNSISYAMTMC
TKTLLGDPVPTPQFATTAHQRSPTVAFQSCVETLQLCVEQQRHHWKSLVFGCKLPQFVLG
ENNNEDFLAATMDRLSISNDDPLGAAGGDIDAQPDPGQDRPSGSKPKVKVKTLSEFMAEH
KEALEQQEMFAIYPLKSCPHLSLLRPEEVPKSIKTNGACGDCASTVENWVCLSCQSIGCG
RYINEHMEQHCRRAKHPLVLSFSDLSVWCYECSAYIDHPLLYAYQNLAHLDKFQEPMAWT
HGCMQRSDGCYPIEAEHQDNDRNSDRDKDKDKDKDSGSSNTNSSSIGSGYYIQLERNN
Download sequence
Identical sequences 7244.FBpp0231468 FBpp0231468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]