SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0231623 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0231623
Domain Number 1 Region: 96-177,208-426,468-539
Classification Level Classification E-value
Superfamily Serpins 3.27e-93
Family Serpins 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0231623
Sequence length 551
Comment (Drosophila virilis)
Sequence
MLRSLCGGLLAFACLFSMGNSDLELFRDIRNQENQALVQKYYNAHSTLPPLLSPGLVASL
SAPAEYASPSYSYSAGSDSGSRLDSSAGYVDVAASDDIARHILTFAQNLSKQINSSNRKT
TVFSPLSIMSALALLLLGAKGRSYTELIAVFGQSDMVKLHEQFGLMLQDVQQPTRQTTSP
HRQLDAWHSNSIRRSLRTYPRNRNAPQEVHVANGLFLQYGYSLNPDYRQAIMEIYKSDLQ
TLDFQRSPAISKYNINSWVEQHTKGKIENILTDDLPQDTRIIMANALYFKAMWEIDFIGG
ATKVEEFYPNGEGNQPVLPVEMMVGAGAFPYYEDPQLNCRIIGLPYHGNLTTMYVIQPMR
SSVVELAQLQQRLSADAIEHMIGQMSRRSIIIAFPKLHITESFKLHSLLERMGIGGIFNP
VQSDLSLIGTNQPAAAAAPVATDRSHADGLASLRNLVAQRQAAMSVQGPTPPSDLIVSDI
LHKVDFVVNEQGTEAAAASAAILKKSGPEVVFRAETPFMLLVRHDLTKLPLFYGLINEPP
TVKAASAERKN
Download sequence
Identical sequences B4LTS8
7244.FBpp0231623 FBpp0231623 XP_002051824.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]