SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0231719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0231719
Domain Number 1 Region: 161-465
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.73e-38
Family NodB-like polysaccharide deacetylase 0.014
Further Details:      
 
Domain Number 2 Region: 56-105
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000471
Family Tachycitin 0.027
Further Details:      
 
Domain Number 3 Region: 117-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0231719
Sequence length 527
Comment (Drosophila virilis)
Sequence
MSSHATSIDNANEPERAAGAGGNHSRHRRSSSSAVCMHDARFYRNPNRPVHKIWTNSECA
KYFLCLDGEVFEFKCSEGLLFDVVRQICDFKANVDNCDISAETPAPKPLLEMADCADETQ
LGCADGTCLPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCQLPHCFCSKDGTQ
IPGNLQAQTVPQMILLTFDDAVNHDNWELFSKVLFTANRRNPNGCPIRSTFYVSHPYTNY
QYVQKLWNDGHEIAVHSVTHRGPELWWSKNATIEDWFDEMVGQANIINKFASVRMEELRG
MRVPFLRVGWNRQFLMMKEFGFVYDASMVAPHSNPPLWPYTLDFKMPHSCLGANQNCPTR
SYPGIWEIVMNQLEAGAGEYTCGMVDSCPPHLTGEDVYRMLTYNFKRHYLSNRAPFGLYF
HSTWFKKIDYLNAFLKFLDDMQKLPDVYFVTNQQAIQWMRKPTPSNQLHQFEPWHCQPKQ
LEPHEQVCQMPNVCKVRSRVLQEDRYFYTCMECPAQYPWIRNEFGLE
Download sequence
Identical sequences 7244.FBpp0231719 FBpp0231719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]