SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0234597 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0234597
Domain Number 1 Region: 9-54
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000354
Family cAMP-binding domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0234597
Sequence length 57
Comment (Drosophila virilis)
Sequence
MKRLQLSSVTLCNLGVGATFGESILHDLPRDSTVVTKTTCELLRVEQQDFRLIWEVS
Download sequence
Identical sequences FBpp0234597 7244.FBpp0234597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]