SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0235825 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0235825
Domain Number 1 Region: 121-189
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000366
Family Insect pheromone/odorant-binding proteins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0235825
Sequence length 249
Comment (Drosophila virilis)
Sequence
MFKRVTLLLALSLCLSEIPQLTWARSVSVSLNMSLTRSEPDERNERMAPAKLNQELLQSC
MRETDVSMSQLKFFRLSLLFNDNNNGENELALAPGDGADAELSTGNNLPDLDYGNATPFL
DLKRNEPLQCFVRCLYESLGLVHYDMMLEEAFRMQLQGLMQRLKPELKECRDMSSKNRCE
AAYKLHLCYNHLKNLETEQRLREVLERSETGGDPAAMDNEENENENVVSEADKTNEISQR
FSETTAQAA
Download sequence
Identical sequences FBpp0235825 7244.FBpp0235825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]