SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0236191 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0236191
Domain Number 1 Region: 194-427
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-82
Family SSRP1-like 0.00000472
Further Details:      
 
Domain Number 2 Region: 550-627
Classification Level Classification E-value
Superfamily HMG-box 1.7e-23
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0236191
Sequence length 729
Comment (Drosophila virilis)
Sequence
MVDALEYNDINAEVRGVLSSGRLKLTEQNIIFKNNKTGKVEQIAAEDIDLINSQKFVGTW
GLRIFTKSGALHRFSGFRDSEHEKLGKYIKEAYSQEMVEKEMCVKGWNWGTARFMGSVLS
FDKDTKTIFEVPLSHVSQCVTGKNEVTLEFHQNDDAPVGLLEMRFHIPAVESADEDPVEK
FHQNVMNKASVISASGESIAIFREIHILTPRGRYDIKIFSTFFQLHGKTFDYKIPMDSVL
RLFMLPHKDSRQMFFVLSLDPPIKQGQTRYHYLVLLFAPDEETTIELPFSEAELRDKYEG
KLEKELSGPVYEVMGKVMKVLIGRKITGPGNFIGHSGTAAVGCSFKAAAGYLYPLERGFI
YIHKPPLHIRFEEISSVNFARSGGSTRSFDFEVTLKNGTVHIFSSIEKEEYAKLFDFITQ
KKLHVSNMGKDKTGYKDVDFGDSDNENEPDAYLARLKAEAREKEEDDDDGDDSDEESTDE
DFKPNENESDVAEEYDSNVQSDSDEDSDASGGGGEGDSDAASKKKHKEKKREKKEKKEKK
HKEKERTKKTTKKKDSNKPKRATTAFMLWLNDTREQIKRDNPGIKVTEIAKKGGEMWKEL
KDKSKWEEIAAKDRQRYQDEMRNYKPGAGAGSDDEDSPSSKPVKKRTSEPSPAKKANTSG
SGFKSKEYISEDDSTSSEEAKKTNSEPAKKKSKTVEPTSNKTAKQSESEAEATEEETNES
NDDEDDASD
Download sequence
Identical sequences B4LM83
7244.FBpp0236191 XP_002049768.1.90633 FBpp0236191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]