SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0236297 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0236297
Domain Number 1 Region: 573-635
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000509
Family PHD domain 0.0032
Further Details:      
 
Domain Number 2 Region: 242-308
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000709
Family PHD domain 0.0048
Further Details:      
 
Domain Number 3 Region: 649-714
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000014
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 202-255
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000111
Family PHD domain 0.024
Further Details:      
 
Domain Number 5 Region: 527-582
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000146
Family PHD domain 0.02
Further Details:      
 
Domain Number 6 Region: 338-401
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000598
Family PHD domain 0.025
Further Details:      
 
Domain Number 7 Region: 1148-1200
Classification Level Classification E-value
Superfamily HMG-box 0.00000754
Family HMG-box 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0236297
Sequence length 1458
Comment (Drosophila virilis)
Sequence
MSLNMLGNIEDKSVVTGFDDLPYFPENFPGKVCCLCNLGERSALGQGTLMQLKVPSSFKE
RKSTETEKDQESLRKFKCGLKSKSAGNSESTYELDKIGYADIVNTSVFFDDEFIYVHRMC
VMWTLRKIHIKDPDVIQFISHLSSYLEQKCSFCGQYGASITCKMNCRQVHHWPCSSAAGC
LLILESFTVFCTEHLSQVPIICTDNNVECLTCSSLGDLSKLIMCCSCGDHFHSTCIGLAN
LPDTRSGWSCARCTKCQICRQHETNDIKFIKCEQCQKMYHAMCLRPTISSIPKYGWKCNR
CRVCTDCGSRTPGGGSSSRWHSHYTICDSCYQQRNKGFSCPICQKAYRAAAYKEMVKCSW
CHKFVHSTCDEEADLTAYHKKKEYNPDYDYVCPICKTSSTAAQLKAVDPLERAITDMQNA
EQFNIKHVEIESLNGRTCIEGNSEDPLKLPSTKKKVCLTNIRGKGGKFVLHRIGAMSQLG
KKRSSRGKGRQLVLQTGSNDRYISRNLDTDLSSDKKMLLCSARDKFVLSQDICVMCGTLG
IESDSVLITCAQCGQCYHPYCASVKHSRGILQKGWRCLDCTVCEGCGKKNDEARLLLCDE
CDISYHIYCVKPPLETVPHGNWKCSFCTICQKCGRNPTEKVKNSDASLSECLPCASQNSC
PLCRKAYSDGEMIIQCEQCEQWSHFLCDSINAQYTMEYYDNNVYKCMKCRSSSKAILPVN
ATPFNEDSLTTSKLLPEAGQGGKTTNLSDRNIRLPNELLESTEAIHWIDGVCLSENGLNM
IKSLSTEIKRKRKMRQPTSNSNKDAQNETVVSDDVQGDKYKDGMIWDRTETVLPDGFSIS
TNDDGVQVLRKKRQRNLQKLGIGGFSVRNRALKKDNDDSVDQLNAILVLDKKKKIIRKKQ
KNKLIEAYPAYLQEAFFGKPLLESGDVVVYDSDSSDEIGTTMKMFFTHSNERVSDIDITN
KNQLKPIKNTKGEKPLNENKNIFGSQFSTTTQQNKTQISAGAIADSSLSDISRNAAPNMH
ALDSMTSQGISELDEINVPINFIPSADNTKNAISVSATLVDPFTAPPQLAQDRKFQSKPV
LPANKLSHMQNQPKTQNITGQQQNEIRVVEEPKPTETIECINVGTQKTAEKMRKDEDLGL
MATISAVLYANTEHANLKELYPNWTDRCKQILKRWRSLCNEKKAPFLQKAKDNRSALRQR
REQCKVSQPPKLETKPDDGRSWKNPPCRPKEDQSNLFGNYNGISYDHQSCYIGTATHSNN
SHQPTEISNENVVVKSAIQRTTMQAASSLKVSPMETRMEHNAAYEPEPVGDKKLRNLLQK
TNSETVLNNSNSEFFLPNDVLRLGLIQNTALTQNNPMLSMSGNPQHTDMRSLEHDGKANL
EIKISESQEGISSSAVELENVGFGDILGGFGEGDDDDLLKSLTSEIGDDFNILEYADPEL
DVNVLNTLDFEETEKNSA
Download sequence
Identical sequences B4LNY9
XP_002049965.1.90633 FBpp0236297 7244.FBpp0236297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]