SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0238608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0238608
Domain Number 1 Region: 341-600
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.47e-86
Family STAT DNA-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 601-724
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-20
Family SH2 domain 0.00063
Further Details:      
 
Domain Number 3 Region: 195-346
Classification Level Classification E-value
Superfamily STAT 0.0000000000000159
Family STAT 0.0095
Further Details:      
 
Weak hits

Sequence:  7244.FBpp0238608
Domain Number - Region: 1-109
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 0.000118
Family Transcription factor STAT-4 N-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0238608
Sequence length 777
Comment (Drosophila virilis)
Sequence
MSLWKRISSHADCEQRMAAYYNKKGLYDLRLCLAPWIEDRIMSEQITPNSTNQLERVAIK
FIEDLQQKLLSTRASDQVLKYRLVELCALIQRTPALELYTHLRSGLQKELQLAAEKSVAV
AAAGQSMPLNTYNMNNAVSAAAAVVGMNGGYVDTSDLLGVAGSSPVAAGMSTGIMHNMGE
NATAGPMATPKVELYEVHHQIMHSLNEFSRCTDSLKVLVQSYRYMINAPNSPEAETLFKR
LIEEKSSLVARLRRSFLYYDSLQDMVIAELKNWRRQQALAGNGAHFSENMLDDIQRCFEL
LESFVIHLLSAVKETIFVRLMNDDPDLNCLLEQVQVAQKNLVCSAFIVDKQPPQVMKTNT
RFAASVRWLLGSQLGIQMNPPTVECIIMSELQAQRFVTRGTHMDVTHSSLAGQSSGEIQN
CSSTMEYQENNHVFSASFRNMQLKKIKRAEKKGTESVMDEKFALFFYATTTVNDYQIRVW
TLSLPVVVIVHGNQEPQSWATITWDNAFADIVRDPFVVTDRVTWRQLSVALNTKFGSCTQ
RALTSENLEFLFEKLHRDNIVGERNNEHISWNQFCKEPLPDRTFTFWEWFFAIMKLTKDH
LLSMWKAGRITGFINKAKAHDDLLRAVTGIGTFLLRFSDSELGGVTIAYVNECGSVTMLS
PWTARDFQILNLADRIRDLEMLRCLHPTDINVQPLDRDLAFGDFYTQRTEPTPRVDGYVP
STIRVQVRTTGDTGSISGTPHHPMQSPPQDSMSMGNGSDFPMADFDTMQNFDVYNRL
Download sequence
Identical sequences FBpp0238608 7244.FBpp0238608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]