SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0238679 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0238679
Domain Number 1 Region: 43-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000314
Family Tachycitin 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0238679
Sequence length 103
Comment (Drosophila virilis)
Sequence
MRFAALLLVLAVCLCLASNALGQCIDTYKPGCKLPVEVGRPQRNCIDPTKYWMCSALNGE
AELFKCQPNTGFSQDRNACISWIDWVWKPCIEPPSRPTGWQSC
Download sequence
Identical sequences B4LWB4
XP_002054128.1.90633 7244.FBpp0238679 FBpp0238679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]