SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0258436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0258436
Domain Number 1 Region: 81-137
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000109
Family Insect pheromone/odorant-binding proteins 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0258436
Sequence length 212
Comment (Drosophila yakuba)
Sequence
MLSRSQLLLLVVGFCLNAAVSADVDCSKRPPFVNPKTCCPMPDFVTAELKEKCAKFDMAP
PPPTDGDASGSFESKRRHHHPHPPPCFFSCIFNETGIYQNRNLDEDKLKSYLQVIFKDST
DLQTTATEAFTTCATKVAEFEANLPPRPGPSPPPGFPICPHDAGHLMGCVFRNLMKNCPD
SIRNDSQQCTDMKEFFTKCKPPRGPPPSGEDM
Download sequence
Identical sequences B4P4Z8
7245.FBpp0258436 FBpp0258436 XP_002091007.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]