SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0266880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0266880
Domain Number 1 Region: 272-338
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000201
Family Tachycitin 0.03
Further Details:      
 
Domain Number 2 Region: 151-212
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000418
Family Tachycitin 0.022
Further Details:      
 
Domain Number 3 Region: 89-155
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000126
Family Tachycitin 0.02
Further Details:      
 
Domain Number 4 Region: 326-393
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000152
Family Tachycitin 0.021
Further Details:      
 
Domain Number 5 Region: 483-533
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000288
Family Tachycitin 0.085
Further Details:      
 
Domain Number 6 Region: 405-465
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000115
Family Tachycitin 0.04
Further Details:      
 
Domain Number 7 Region: 208-271
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000123
Family Tachycitin 0.029
Further Details:      
 
Domain Number 8 Region: 34-83
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000175
Family Tachycitin 0.025
Further Details:      
 
Domain Number 9 Region: 534-589
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000418
Family Tachycitin 0.026
Further Details:      
 
Domain Number 10 Region: 640-701
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000575
Family Tachycitin 0.023
Further Details:      
 
Domain Number 11 Region: 590-638
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000141
Family Tachycitin 0.038
Further Details:      
 
Domain Number 12 Region: 992-1055
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000602
Family Tachycitin 0.096
Further Details:      
 
Domain Number 13 Region: 753-802
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000732
Family Antifungal peptide scarabaecin 0.069
Further Details:      
 
Domain Number 14 Region: 810-870
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000123
Family Tachycitin 0.054
Further Details:      
 
Domain Number 15 Region: 874-923
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000366
Family Tachycitin 0.044
Further Details:      
 
Weak hits

Sequence:  7245.FBpp0266880
Domain Number - Region: 698-749
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000162
Family Tachycitin 0.033
Further Details:      
 
Domain Number - Region: 1058-1111
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00288
Family Tachycitin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0266880
Sequence length 1314
Comment (Drosophila yakuba)
Sequence
MNATLLTVVALTAVAALVGAADPECLYRRTRNLSMHWPKPLNCSSYYRCSAKNSVRTVTC
PPGKEYNPKNGKCTIAGRSLCKLSLIAPLAESTNVCSTEVNGAYIANSGACGEFYICDEQ
SAYPQKCDLGSYFNETLAACVPDTNSTCWQNLCINKTNGAFLANDENCGSYYACSDGEAT
LTTCPQGSFFNTSVNACTVDEGNSQCWVNYCIGQSDGSAVADKSNCTVFYVCSDNTATAQ
ECPEGSYFEDTNWGCVPGTCTTEAPCDEVTTPPPASCDCGDIKNADFIPDEENCRKYFIC
IDGVLVAGDCGKGNFFNATLSVCEVDVDNTCCVADCTDGEAKVDPQDCTKYFKCQSGDWT
SVSCDSGSYFNATVNCCQVDVNNVCISASTTSTQSPTTSTEVIPAPTSEVYKCNARDPAA
SGKNCWTYQVCINGQWEDGTCPNNTYFDASVGVCREDTENVCVENRSSGSRQKRSVGDCE
GGIQQGTIVGHSTDCDKYLICENGQLVEGVCGFGNVFQNSSGVCVPDTKATCWVCSNKPN
GYQMPDPTDCTSYLTCWDGLATKHTCGSGEWYNADGECAIDVNAKCINPCTCGNGNVAHP
ICTKYFQCTDGVPKVMQCVSGEAFDSATGQCSTTVECSAKNCATASDGTTYAIAGETGQF
YVCLNHEATIESCPVNTGYSDDLGICYTQPSTDCDQTVCTSTNEYSTYPSGNNDSSTFCL
CENGGGYIKSCPTGLFYDATEDACSFSGNCDPQVCVDQTEYYISPDYEDPNSFCLCRAGT
PISVPCPIGYTFDSEELECVLIPLPDPRCHDCCAGKPEFSTFPALDGTDGFCLCVDEVPK
YNSCPDNTQYDSEAGACLSTEEETTCPVNACDVGVCEDAADYDTFPVSNEPSAFCYCANS
CPVYETCSDDEVYNENLKMCREAEDPSVAGLCDADTCDSTPEYTPYLPNEGTDGFCYCDA
DGFPVYQPCDQNEEFDENLGMCKTIVDACVTALCDSDQCAILGNYVPFPTNNANEDTGEF
CYCDNGEVVLVQCSPEMVFDAEQGRCAVRAASECVCEPGKCDNSDDYNSYPALNTNEGFC
LCVSGTPVFKDCSEGQSYNSVFGACLDSTKALAFGLCDDRQCHSRALVAATFAAVNTTSG
YCRCQAVGVSTFISCADEHVYEQSAGACVVEACEYTSCLNRAAFEAFEAKNTTEGFCSCD
DVPNFHHCQAGHVFDKTQGICLLKDAMAMISCNLKECLRRSQYEPFAAENTQSGFCSCDD
LQRVSVTYHPCGEGETFVPELGLCASHSIQKRSVESEENVRSLNLFKKFFPKLF
Download sequence
Identical sequences FBpp0266880 7245.FBpp0266880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]