SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0270811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0270811
Domain Number 1 Region: 64-163
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000000000687
Family Insect pheromone/odorant-binding proteins 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0270811
Sequence length 175
Comment (Drosophila yakuba)
Sequence
MYSALVRACAVFAFLNLSLNCAKALQDHAKDNGDIFIINYDSFDGDVDDISTTTSAPRDA
DYVDFEEVIRNCNASFITSTTNVLQFNSTGELQDDKDRATSMCYFHCFFEKSGLMTDYKL
NTDLVRKYVWPATGDSVEACEAEGKDETNACMRGYAIVKCVFTRALTDARNKPTI
Download sequence
Identical sequences FBpp0270811 7245.FBpp0270811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]