SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0244857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0244857
Domain Number 1 Region: 574-635
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000642
Family PHD domain 0.0034
Further Details:      
 
Domain Number 2 Region: 647-716
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000106
Family PHD domain 0.01
Further Details:      
 
Domain Number 3 Region: 249-304
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000021
Family PHD domain 0.0058
Further Details:      
 
Domain Number 4 Region: 198-251
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000842
Family PHD domain 0.018
Further Details:      
 
Domain Number 5 Region: 529-582
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000109
Family PHD domain 0.02
Further Details:      
 
Domain Number 6 Region: 331-400
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000432
Family PHD domain 0.014
Further Details:      
 
Domain Number 7 Region: 1191-1238
Classification Level Classification E-value
Superfamily HMG-box 0.0000251
Family HMG-box 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0244857
Sequence length 1503
Comment (Drosophila willistoni)
Sequence
MNTNPEDKTIIACSNINDDLPYFTEKFPGKVCCLCNLGEKSALGQGVIVQLTVKSDFKHP
DRENNEERKFNYGTRQQPTSVSTGECNYELDKIGHSEIVHPSAFHEDGFVYVHRMCLMWS
LRKTQITETDVNQFLTLMGEVLEQKCVFCSQYGASINCKMNCRTVHHYPCAAAAGCLLIL
ESFTVFCTEHLSQVPLICSDNNVECLSCSSLGDLSKLIMCSSCGDHFHSTCIGLANLPDT
RSGWCCARCTKCQICRQQDSNDIKFVKCEQCQKIYHASCLRPVISSIPKYGWKCNRCRVC
TDCGSRTPGGGSSSRWHSHYTICDSCYQQRNKGFSCPICQKAYRAASHKEMVKCSWCHKF
VHSTCDEEADLMAYHKKKEQNPDYDYVCPNCKTNSTRPPQSQLTETIDMALSESQTSDTQ
LMVKDIEMDPLEGRPTTNDVISEENHKQPPGAKKKVCFSNLRGKGTKFMLQRMGVMSQIS
KKRSTRGKGRQMVLASNSSDRYVNRNVDPDFGSDKKMLLCSARDKFILAQDICVMCGSLG
IESDAVMITCAQCGQCYHPYCASVKPSKGILQKGWRCLDCTVCEGCGKKNDEARLLLCDE
CDISYHIYCVNPPLETVPQGTWKCSFCTMCQKCGRNPTEKSDNVDSNMSECPPCASQTAC
SVCTNPYANGEMIIQCEKCEQWSHFLCDSVNAQLTIDYYDKNIYKCLKCRSNAKPQLSAA
TSDTNIAGNEDIKPATGHKLQTQMSSTGSVIDGGKAGASGLDRNVMLSSEINESPEAIHW
IDGVCLSENGLNMIKSLSTEIKRKRKMRQPMGKDGQLDTTTPDEVPNDKYKDGMIWDGTE
ATLPEGFSISTNDEGVHILRKKRQRNLQKLGIGGFSVRNRAVKKDNEETTVDPINSGVGM
DKKKKIIRKKQKNKLIEAYPAYLQEAFFGKPLLESGETVQYESESSDEIDTSMKMYFTRP
DTKTPETETLPAIKSPAKTLKKVKQEKTIPDTKPPAFAEQYSVVSHSMVTQASTPTNLFD
STNPGEIPPTPAPIRHTMEAMAPQNMSEVDGTNTSVKFLPSSDNMEKPLGDAPVVKIENY
SVTQQVGPPEQKFHGHLYMPANITTNSPQHQLHYQQQQQPPDTLIQQNRQNIPTMIGQGQ
VYMQGEIKRVEEVSKPNDIAPEGLNAGTQKTAEKMRKDEDLGLMATISAVLYANTEHANL
KELFPNWNDRCKQILKRWRSLCNEKKAPFLQKAKDNRSALRQRREQSKITVPQKAPPKQE
QDLSRTWKQQHPSGKLKQEQSNMFVSYNPIQYDNTMCYVGPVATTPTTPQATHVSPLIND
NMMVKAASSTSIKVVSTSDNRLELNSVYGTEPIGDKKLRNLLQKTNSEPMLMGNNSELFM
QNDVLRLGGLMANPALIQNNPMLSTSGKSQLLEGRTLEQDVKNHPDLKMSESQEGISSSA
VELENVGFGDILGGLGEGDDDDLLKSLTSEIGDDFNILEYADTELDVNVLNTLDFEDNEK
CSN
Download sequence
Identical sequences B4MRN9
FBpp0244857 XP_002063792.1.14588 7260.FBpp0244857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]