SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0249165 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0249165
Domain Number 1 Region: 547-910
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.49e-111
Family Histone deacetylase, HDAC 0.0000012
Further Details:      
 
Domain Number 2 Region: 113-470
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.93e-104
Family Histone deacetylase, HDAC 0.00000178
Further Details:      
 
Domain Number 3 Region: 997-1092
Classification Level Classification E-value
Superfamily RING/U-box 7.3e-25
Family Zf-UBP 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0249165
Sequence length 1136
Comment (Drosophila willistoni)
Sequence
MPVKKNPEIKSEQSSPIVTRRSAQQAKIQTRAMVKSTSTSTSAAAATSTAAAAGATLSNR
SGEARKPSAALLEAKRRARNQLKAQSNMSNIVMHETVTDIFQNAVNAKGMLRGPTALIFD
ETMSQHCCLWDKLHWERPERFTRVLERCQELKLVDRCLRIKSRSATKEEILKLHTAEHYE
QLELTSGIRDDENMEELSSHFDSIYIHPSTFELSLLASGSTIELVDQLIMGKAQNGMAII
RPPGHHAMKAEFNGYCFFNNVALAAKHALDKHKLQRILIIDYDVHHGQGTQRFFYDDPRV
LYFSIHRFEYGSFWPNLHESDFHAIGTGAGQGYNFNVPLNATGMTNGDYLAIFQQLLMPV
ALEFQPELILVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLASCRVAVVLEGGYCLES
LAEGAALSLRSLLGDPCPPLVEPVQIPRQELTEALLNCIYAHRPYWRCLQLQKTYDTNSQ
LVGDHLTESSPNVDEHRVHRVWIGGPPAMDRYPTRDTAILLPPEVHARNKARLRILRAET
KLSAPTVRVCYAYEEEMLQHCNLHDVGHPEQPMRIKHIHQMHKEYELLTRMMPLMPRAAT
TDEVCLAHTRSHVNSIRRLLGRSPEELQELGAGFNSVYLHPRTFDCATLAAGSVLQAVDC
VLRGETRSGICNVRPPGHHAEPDQPHGFCIFNNVAIAAQYAIRDFGLQRVLIVDWDVHHG
NGTQHIFEANPKVLYISVHRYEHGSFFPKGPDGNYDVVGKQAGRGFNVNIPWNKKGMGDM
EYALAFQQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGLFTHWLSALAGGK
IIVCLEGGYNVNSISYAMTMCTKSLLGDPMPTPQFNNGSGDARKPPTVAFQSCLETLQSC
LEVQRHHWKSVDFVNRRLPAGQGVVSENNNEDFLAATLQQLSLSNDQDAQGAAGGAQGDQ
RPSGSKPKVKVKTLTEFMAENKEALESEEMFAVYPRKNCPHLDQVLKELPPSINTNVACG
DCSSLTENWMCLSCQKIGCGRYINEHMEKHCLKHSHPLALSFSDLSVWCYKCSDYIDHPS
LYNILNLVHLSKFQEPMAWTYSCEKREDGCYSNQLDKDEDDGQNGSNFYIHLERDN
Download sequence
Identical sequences FBpp0249165 7260.FBpp0249165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]