SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0250591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0250591
Domain Number 1 Region: 78-135
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000667
Family Insect pheromone/odorant-binding proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0250591
Sequence length 205
Comment (Drosophila willistoni)
Sequence
MLKFNFIICLIFCHMSFSLAIKVHCRHVERIHEDHIHLCCKHPDGHNDVSEMCAKKTNFK
YLPSASEEALEDVTVDQVMLGACWAKCVFDHYGFLKKDDETLNMMAVHTHYKMYHKTDPE
YETEMLAAFDRCHSQSEEAMTKFLSMTFVKALSDSNYCKPASSVILSCVIYHFFHSCPKN
RWSNSTECTETLAFAKKCKDVLTTM
Download sequence
Identical sequences B4MQB8
XP_002063321.1.14588 FBpp0250591 7260.FBpp0250591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]