SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0250832 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0250832
Domain Number 1 Region: 47-138
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000445
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 
Weak hits

Sequence:  7260.FBpp0250832
Domain Number - Region: 139-210
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.00235
Family Nickel-iron hydrogenase, small subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0250832
Sequence length 216
Comment (Drosophila willistoni)
Sequence
MLTKSQLFLFVALALVYVNSTGAADVDCSKKPPFMNPRTCCPVPDFLTADLKEKCKEFDT
TPSPASVEASGEGGRGRRHHPHHPPPCLFSCVFNETGIYVDQKLNSAKLDAYLKVVFKDS
TELQQLTTEAFNNCTTKMAEFKAKMGDRQPPPPPPGMPMCPMDSGFLMGCVFKKTIKNCP
ASIWNNTDDCNNMREFFNNCKPPHRGPGGPPSAEDM
Download sequence
Identical sequences B4MPE8
XP_002063001.1.14588 7260.FBpp0250832 FBpp0250832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]