SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 73239.Q7RD33 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  73239.Q7RD33
Domain Number 1 Region: 108-220,259-362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.54e-45
Family RecA protein-like (ATPase-domain) 0.000000752
Further Details:      
 
Domain Number 2 Region: 25-87
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000188
Family DNA repair protein Rad51, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 73239.Q7RD33
Sequence length 365
Comment (Plasmodium yoelii yoelii)
Sequence
MATLPSSKSTSKVALTTNVEDVPKEQQFQEIEKLQDLGINAADINKLKGSGYCTILSLIQ
ATKKELCNVKGISEVKVDKILEVASKIENCSAFITGNQLVQKRSKVLKITTGSSVLDKTL
GGGFESMSITELFGENRCGKTQVCHTLAVTAQLPKSMQGGNGKVCYIDTEGTFRPEKICK
IAQRFGLNSEDVLDNILYARAFTHEHLYQLLATSAAKVVHTPACALLTYTLLTYALLTYA
LLTYTLLTYLLHFCERYFSGRGELSERQQKLNKIMSVLSKLGEQFNIAIVITNQVMSDPG
ATMTFIANPMKPVGGHVIGHASTTRLSLRKGKGDQRVCKVYDAPNLPEIECIFQLSDGGV
IDALD
Download sequence
Identical sequences Q7RD33
gi|82595964|ref|XP_726066.1| 73239.Q7RD33 XP_726066.1.76580 1798.m00039|PY05593|PY05593|DNA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]