SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001604615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001604615
Domain Number 1 Region: 85-132
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 56-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000107
Family Somatomedin B domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001604615
Sequence length 283
Comment (Nasonia vitripennis)
Sequence
MKKSPASSLALLLLASSLYIGYVSAGSCAESKLCCPGRDSACVVQKTSPNAIIQSLSDKP
CYCDHACLKLGDCCDDFKEACGVLDCVVSGWGPWTACDSECGPGAQTRSRMVERAPENGG
KHCPQLVQHRGCQGTKCHRRNPKTALKEVALLLPAELSNSRHMNDSNDIRTNLRLQYRED
PEHDASKEYCVTFTVTKASKACYKEPSLSELAEGSRVCVRCQMQALRRVLDWRCEGDGGT
EAMITRWSMLSSAHCHGKWLRTKKTGPECDASLCQPRPHFIFV
Download sequence
Identical sequences K7J5P5
XP_001604615.1.61660 7425.XP_001604615 gi|156555111|ref|XP_001604615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]