SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001605616 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001605616
Domain Number 1 Region: 447-637,710-1035
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.82e-68
Family Tandem AAA-ATPase domain 0.026
Further Details:      
 
Domain Number 2 Region: 202-244,289-355
Classification Level Classification E-value
Superfamily UBC-like 0.00000747
Family UBC-related 0.036
Further Details:      
 
Domain Number 3 Region: 255-281
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000994
Family CCCH zinc finger 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001605616
Sequence length 1271
Comment (Nasonia vitripennis)
Sequence
MDHYSAQLMDDIVLEARGSPKPNSSKSNAKSTNSKTANVNVKSTNPPIPPKDKPKSEQPT
FRSLKVEMQTLRVSQESEKQLYDTLKHIHGSGFRLANPSEFENKNTNLGKQYWLQRGNLI
IKGITNYSAKEAGVKSHEQITRDFATSKLETYNFHASHCAEALAHTEGHMGKALELLFYK
YYGIENLPKKDNFDGVDLNDLLQRRQEEKEALESIYGDSFKEKIKNQIWIFNVKLDYLVK
TDEDKKIKSKPKPLSKDICRLYLQGKCRFGIKCRFLHQQPEPAEKPKAKIDSMFTLEIRF
PDDCKYPYEPPYFYFYKSDGTFPALNSLRIARRLHNEALTFCEDGIPSMYSVISLLENEE
EILSYLSENKEFFLDQDDPLFAKSSEIEKDGPTHYKKGSTNKKNRDEIAWDDILRQDIEI
KAKFMNKQKNPHYLKMKDVRRKLPAWSKMNEVLETIHENQVTIISGETGCGKSTQVPQFI
LDDWIINMSEESKEHVEIVCTQPRRISAIGVAERVAAERDERIGNTIGYQIRLESKVSSN
TRLTFCTTGILLQRLSGDPQLKSVTHIIVDEVHERSAESDFLLMLLKKLLRQRRDLKVIL
MSATLKSDIFSTYFGGVPVLDIPGRTFPVTQFFLEDILEMSNYVLEENSKYTRKIKGGWE
QLNVELETADAESLATVAPKNTILDENLTLPQIMGRYSDYSRSTHKNLYVMDHEKINFEL
IERVIEWIVDGDHDYPRSGSILVFLPGIAEIMSLKDLLNDNRMLSPKSGKFLIIPLHSTL
SSEEQSLVFKRPKPGVRKIVLSTNIAETSVTIDDCVFVIDTGKMKETRFNSNQNMESLEM
CWVSRANALQRKGRAGRVMSGVCIHLYTSYRFNYSFLAQPIPEILRISLEPLLLRIKILH
KSQDVDLYQSLGKLLEPPAQDSISTAIKRLQDVGAFDPESMLTPLGHHLAALPVDVRIGK
LILFGAIFCCVDSALTIAACLSHKSPFVVPFDKKYEVNAKKKEYATANSDQLTTLKAYRK
WLEISAHGYLAGQTFANANFLSVRTLQTLADIKHQLLELLVSIGFVPVNIRKRPMGQDKI
LEVTGQELNTNNENYNLLQGLLCAALYPNVVKVFTPEKSFQMQSSGAIPRQPKPEELRFQ
TKEDGMVNIHPSSINFSVGYYTSPYLVFQEKIKTSRIFIREVTMVPMLALVLFSGYGIDI
ELHNGTFILSLGDGWIMFAVESHRVAQLLQYARVELIKLLEQKMEDPLLNLVNHPHGRKI
IRTIVNVVTNG
Download sequence
Identical sequences K7INT6
gi|156538393|ref|XP_001605616.1| XP_003426609.1.61660 7425.XP_001605616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]