SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001608187 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001608187
Domain Number 1 Region: 119-181
Classification Level Classification E-value
Superfamily RING/U-box 1.29e-18
Family ZZ domain 0.0083
Further Details:      
 
Domain Number 2 Region: 416-463
Classification Level Classification E-value
Superfamily UBA-like 6.97e-17
Family UBA domain 0.0033
Further Details:      
 
Domain Number 3 Region: 22-99
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000054
Family PB1 domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001608187
Sequence length 465
Comment (Nasonia vitripennis)
Sequence
MSEQVDFKVFLRKNNSRNDNHAEIRRFAIDADVVTNFTYLREKLQTVFPDLRGKRFTITW
KDFENDEIVICSCEELVIALAELQKYPLCKLFVTLHSDYDDENNCPITGPFVHFEATNNP
KTKHAGIVCDGCDKSICGFRYKCVQCSDYDLCSECEAKGLHPEHCMIRISMPLQWRSHYG
RRLSHHINKFMKKASTCPSSAEEETKNCPFKPRRHNLYNHRADQSPSWIDTFTTYLNDWA
NLPGECPVMGEQEKSKTDTSEQNQSTANKTSSASTNEKYPMDSHVEFLKNFSENISKFLD
PLGIENMKKVVTDDDKNHKESTDELIQSAANDSQEKNKLITKTDAKEGNQVTVNDATKAD
DWTLVDKDSVPASSEIASGKIAQNEKKPSEPTVENSKATTDDKALYPSLPNVSDNVWHPN
PKIQGAVEAMLQMGFSNEGGWLTQLLISKNGNISRALDDLQPVRE
Download sequence
Identical sequences K7INC0
gi|156537980|ref|XP_001608187.1| XP_001608187.1.61660 7425.XP_001608187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]