SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_001120264 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_001120264
Domain Number 1 Region: 193-426
Classification Level Classification E-value
Superfamily PH domain-like 6.27e-83
Family SSRP1-like 0.00000295
Further Details:      
 
Domain Number 2 Region: 534-616
Classification Level Classification E-value
Superfamily HMG-box 2.23e-21
Family HMG-box 0.0000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_001120264
Sequence length 728
Comment (Apis mellifera)
Sequence
MDFLEYTDVIAEVKGAMTPGRLKLTDQHLIFKNQKTGKVEQISATDMEMVNYQKFIGTWG
LRIFLKNGTLHRFRGFKEGDQEKIAKFFTQNYKKDMLEKELSLKGWNWGTARFNGSVLSF
DVGHHTAFEIPLYDVSQCNTGKNEVTLEFHQNDDAPVSLMEMRFHIPVSDSADQDPVEAF
HQQVMEKASVISVSGDAIAIFREIQCLTPRGRYDIKIFQSFFQLHGKTFDYKIPMSTVLR
LFLLPHKDNRQMYFVVSLDPPIKQGQTRYHYLVLLFNQEEETSIELPFSEKELKEKYEDK
LPKELSGPTFEVLGKVMKVIINRKLTGPGNFISHSGTLAISCSFKAAAGYLYPLERGFIY
VHKPPIHIRFEEIASVNFARGGGSTRSFDFEIELTSGVVHTFSSIEKEEYGKLFDFITSK
KLRVKNRGKSDKLNYDNDFGDSDQEDEPDAYLARVKAEAEERDAEENQDSEEESTDEDFN
PNQDESDVAEEYDSNPNSSESENDSDVSGKSQKKEKKEKKEKKSKSAKTVSEKPRKPRKQ
KKEKDTNKPKRPPTAFMMWLNSARERIKAENPGIAVTEIAKKGGEMWRELKDKSEWEQKA
AKAKKDYSASMKEYEASGGQKDKKEKGEKKKKENKKESPNKLMSGTSFKSKEYISDDESS
SDEDNKKSEKKGSDEDSEKEKKKGDKRTAEDDDKKVKKGKKEQSDEGSDDEPIESTPPSS
EAEFKDSD
Download sequence
Identical sequences A0A088ASB6
7460.XP_001120264 XP_001120264.1.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]