SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_392222 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_392222
Domain Number 1 Region: 100-168
Classification Level Classification E-value
Superfamily RING/U-box 1.18e-19
Family ZZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 348-397
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000122
Family UBA domain 0.0066
Further Details:      
 
Domain Number 3 Region: 25-90
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000841
Family PB1 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_392222
Sequence length 399
Comment (Apis mellifera)
Sequence
MFKAYLQNSDFSIKEIRKFNLYPSNLSDKFEVLCNKIKELFPELNHKSFTISWKDNDGDQ
IVMSSEDELKIAFNEIRNKEVETKYLAIYIKPTIQKEQKSTTNPYQNDLNEKVIHFGITC
DGCDNDIIGFRYKCIQCEDYDLCAQCEAAGIHPHHCMIRMPQPLKWHHSRSLHHHLRKIF
KKNGVHLNKKTSSNENKESQGIHCNIYPWFETYAPYLNNFIDALLEVHNVESNSSKVEKK
EESKNNSHIDDNDSKKFPGEGRKLFDDTKDDKESVSDVASTTSQDSNPPKVTADEWTIID
TKDTTEANHTASTSSNMNETNEKEKSSSTAPSAPNGTSIYPELPKEKIIHHQNPIINEAV
ENMIRMGFSNQGGLLTYLLDAENGDINKVLEILQPTNKR
Download sequence
Identical sequences A0A088AE88
7460.XP_392222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]