SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_394941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_394941
Domain Number 1 Region: 300-366
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000642
Family PHD domain 0.0062
Further Details:      
 
Domain Number 2 Region: 618-677
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000177
Family PHD domain 0.0042
Further Details:      
 
Domain Number 3 Region: 691-761
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000109
Family PHD domain 0.018
Further Details:      
 
Domain Number 4 Region: 263-315
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000082
Family PHD domain 0.013
Further Details:      
 
Domain Number 5 Region: 572-627
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000206
Family PHD domain 0.014
Further Details:      
 
Domain Number 6 Region: 393-455
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000152
Family PHD domain 0.018
Further Details:      
 
Domain Number 7 Region: 1140-1187
Classification Level Classification E-value
Superfamily HMG-box 0.0000182
Family HMG-box 0.0057
Further Details:      
 
Weak hits

Sequence:  7460.XP_394941
Domain Number - Region: 195-238
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0797
Family PHD domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_394941
Sequence length 2292
Comment (Apis mellifera)
Sequence
MIWFIVTSTSGYARGVPRRTKSKDDDTHSESPSPLRLGEDTPDGETSNTERCMPAPEEPP
YFLEQWPGKVCALCNLGERSQLGQGELLRFTCPEGFTPEKSTNRDEITDHLIDISTGDKS
PRAAGPGAVTCRRQKSLAKCRNTSLTNFSEPVEELTIVGYSEEPEIGTLFESTGHYYVHQ
SCAVCQSNTQELTTESLSPAIVQASSRRCAFCSHYGAGIPCKVASCNRYFHLPCAAASSC
FQDTKSLSLFCSQHLGQVPLLLNGDVTCMQCCGMGDVSNLVMCSICGQHYHGSCVGLALL
PGVRAGWQCASCRVCQVCRQPEDVSKVMLCERCEKAYHPSCLRPIVTSIPKYGWKCKCCR
VCTDCGSRTPGAGLSSRWHSHYTVCDSCYQQRNKGFSCPLCRKAYRAAAYREMVQCSACK
KFVHGTCDPEADPLTYQHRKEVKPDYEYVCLHCKNMALVKRKDNIDDYGGDLSLSASQES
LYGDGDSSEFDYQGGSEEALYSIGLGKGKPFCASKIAKKRLGLGGPKAKMRGIFGVPGVG
LQRPMSDSFSKEDEPGIENRLVLCSAKDKFVLTQDICVMCGAIGTDQEGCLIACAQCGQC
YHPYCANVKVTKVILQKGWRCLDCTVCEGCGERNDEGRLILCDDCDISYHIYCMDPPLDY
VPHGTWKCKWCAHCQTCGSNDPGFNSSWQKNYTQCGPCASHTACISCQEAYNEGDLIIQC
IQCERWLHCACDSIKSEVEAEKCAEEGYICILCRPRDIPPPHLLCSQPKPQPNKYPRSPP
PTSRSPELYKPSPQQYLIDGVYLSEAGMNHIKSLTSEHQQTRKKRRKIHPLIDKEADIMA
TIESVVAVLKEGMVWTPRGDQPPPEGFSIYTTENGIPILRRKRQRNLQKLGIGGFIVRLR
GTRKDKEEDGDTEKPSDSTVVNDDKPRRKPQRRKPKTKLSECFPLYMQEAFFGKDLMDTT
KDKELESSSESDSERNVSGNADTIQLSQDELKAMEQVKAKQEKEEEKVPPEAPIKREEIV
DDEGSDTEALGDILPISGDLLDNDLVNTIMNEPDEDLAKASEALDELDDAPGTTKDELTD
ILSPHFNIESMVRDTGLPNMDSKDIEEIFKGVLTDESQESQEKMEADEALGPGATISSVL
YANINHPEWKTEYPAWSERCKQILKKWRALPNDKKAPYLTLARDNRAAIRMKKTQQISKD
IPSTTPVTATSAPTIITKPVTTMTSAQVSPVVAMASNQRQIGLLTSVGSEKTQEKNGMSV
STAGLTISTVSSNHHAEVCAVQGPPKQLTSTSPSPSPTSTTPSSSPRPSSVNSINSINSL
AHQEISGSQARVAQSSATPCTSATASYCNMGAGEGQHQTSPSQQRPTPAHITISTSTIAN
SLSISQASPTTNVMVGVGPVRQLSSVDHQIRVLTPSEIMRTLPSLSQEHYDPPPTAIIHT
VPVQSPAMEQERLSNRDRSSREAEQERQWKQLQALRQQQAQMQQQVIHEQRVHAITRVHR
QISEDNTTQVNADNTTGLTTQLQVSTSQDGNHMGPLASPSPGSRNTFAAPSIKVTRGLAP
QSPHQNIPRLPTQPCTTMTRPVGNVVRPGMPNNFTQPPSPFSPQAPQSPHDFPQSPASSQ
PQDHFQRFDNTEAYSQASQTPRSQISGTSSYSTSPRSDVFSQPPGTPRPMFNAPTTRPST
HVYAPSRTPDPYSSQPPTPSPAPNYSSPRPESRQDSQQPEVFNQQSEVINNRQLRDLLQR
QQFNKKMEPVSTTWNQDSQNNTESNQQFDTGHVQLPQQAASSTGEGTFRHPLPPSIVRAR
MPIQPNVLIRNQIGINSRHPVAGNIDARIQNIDPRTRMLLQRPQVTATIPQHFQGNQTLQ
TRMPAVRNSITEPYDVLQQQRFPDPNQGQNITQRIVRTPQDNLNQGIRMLNQGVGIRAPL
IPTTVNEATVSPSESSEIPDNVTAELEKLEQEGAPMVEVEGVSAILGDLGDDDDELLAEM
GADFNILEYADPELDNITGGEKTNILDLDLEQVEVETKDEKQKKEVKDDERKSTELNVTN
AVHTDINDTCTTTTVQTPTETSNTPTQAQTVTPITATSQTSQQSSTIMPQSHAQAVVVQQ
QMHQHVQQAAAMGRPMPPGTRLLSPDGAVGVVTSTNTVTVSYPSTFPGHPQRIPQTHIQV
SQQQRLGMRVTGVPNVAGRVVAVNHMIGPRMPLAPPPPPPPPPYPGPPPPYPGPIQYIKV
LAGKMMFSPGCLQCIGVGACLDGAVSRWAGYDAAPNPYRAPSTGGGSTNGPYGTYWYARN
DTSPSPKTLASA
Download sequence
Identical sequences 7460.XP_394941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]