SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_397194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_397194
Domain Number 1 Region: 312-631
Classification Level Classification E-value
Superfamily Kelch motif 5.49e-50
Family Kelch motif 0.0032
Further Details:      
 
Domain Number 2 Region: 92-215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-20
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 3 Region: 895-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000151
Family Laminin-type module 0.036
Further Details:      
 
Weak hits

Sequence:  7460.XP_397194
Domain Number - Region: 223-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family Integrin beta EGF-like domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_397194
Sequence length 1274
Comment (Apis mellifera)
Sequence
MAEVVQMFLFLYKSKYRRKGQCREVVRDQCGVIAVPWPILWAALICWVVHVTAAASSSSS
SLTTDTTCDTDSCVNGDCVNGTCVCHEGWQGSACQFCGGKVKLTEPTGNIHDGIGNYTAD
VKCSWLIESSPNSTIRMHVEQFATECGWDHMYIYDGDSVEAPLLAVFSGLMHKDGYHIRR
VPEVIARSGSALLHFYSDVAYNMSGFNISYKINACPSRYSHIDCSGHGVCIDGVCTCDAT
WTGEACEIQVCPNNCSHSHGQGECNRESHHCDCVHGFKENWIIIDRGFWESVFYTDFSPE
GSASHCSIVWKDSLYIVGGESFHRAKMIYVYDFNGNVWETPHVEGKVPQPRYAHSCILFG
DKIFMYGGVLPNSTVTNEIWAFDVSAKVWENVTVHDNSNKTMRGPLKVAGHSATLVNHGR
KEKMVVIFGYSPQYGYLNEIQEYYLGTREWQIVDTIGFPVKGGYGHSSAYDALTNLIYVY
GGYVSESQTTQVLTSRLYSYDPNFRQWTLLTAAPSARFFHTAVFISGGLMIVFGGNMHND
TQHSDGTRCYSADTIAYDVTCDSWHQFPMPKEMTDLPRYGHSATVFEKSMYIYGGFDGQM
LSDMTRYTPGNCEHLTNQNHCLNARTGVKCVWDKRENRCIQITKISRHVLLNDDMHDGIY
MRCLDDTPPRGMTSHKELCKLLTDCVACVQTSYNCIWCGKSCSHEICRDNANAPPTKAIS
DLEQCDAHTAIKCLQLHTCHACSSNPHCIWSWSNGPDRCKPYSKAREVIVLQDSCRSPCV
DYTSCKNCTESDCIWCQNEKRCVDKNAYPASFPYGQCREWTTVDSKCHPTETGKEWCTFY
SSCAACRSDPGCGWCDDGSGTGKGLCLPGGARGPSTKSLDTCSIERWYFTKCPTCQCNGH
SKCLSNSSICIQPCGNLTYGPHCDKCIPGYYGNPLNGATCQPCFCNNQGTQCTSETGKCF
CTTKGIIGDHCERCDVSSLYHGDPTNKGSCFYDLAIDYQFTFNLSKKEDRQYRAINFKNS
PPKPDIDAEFSITCSVLAKMNITVKRANTPEMPVILGANCTTSMYKHRFIKDGYGFGSEN
NNTLTTFYVYVYDFQPPVWIQISFSQYSKLNLQQFFITFCTCFLALLLVAAVLWKIKQKY
DMYRRRQRLFVEMEQMASRAFSQVLVEIERRDIDNSDSERSESELVNCRKKKKDAPSPIA
LEPCCGNRAAVLSLLVRLPTGGEPYTPAGQSAGLAVASALVTLGSPRRPSQELTTKEPTK
TRKSASQHPDSTCI
Download sequence
Identical sequences 7460.XP_397194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]