SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_623370 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_623370
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-49
Family Calponin-homology domain, CH-domain 0.000000655
Further Details:      
 
Domain Number 2 Region: 213-275
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.32e-20
Family EB1 dimerisation domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_623370
Sequence length 293
Comment (Apis mellifera)
Sequence
MAVNVYATNVTTENLSRHDMLAWVNDCLQSSFTKIEELCTGAVYCQFMDMLFPGSVPLKR
VKFKTNLEHEYIQNFKILQGGFKKMNVDKVIPVDKLVKGRFQDNFEFLQWFKKFFDANYD
GREYDAYEARGCIPLGSGAGSKTTLKPYDALAMRGGEPMGSGGSNAPHGTNTKRTTPRDV
NSAKPAARIVTKAPAHRPQAKTGVGNRGEAGKVEELSAQVMELKMSLEGLEKERDFYFGK
LRDIEVMCQDCDNGDPPPIVQKILEVLYATEEGFAPPEELEGDGLAPDDEEEY
Download sequence
Identical sequences 7460.XP_623370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]