SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_792258 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_792258
Domain Number 1 Region: 10-257
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.73e-63
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 264-323
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000314
Family Calponin-homology domain, CH-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_792258
Sequence length 326
Comment (Strongylocentrotus purpuratus)
Sequence
MERNNSSSISAPWVQIQQKTFTNWVNEQLRPAGKQVDDLVTDFEDGLMLITLLDGLVASR
GLPMYKKRSSYCKNPKLRVQKMENVSHALQMMERAGIKMVNVGNEDIVEGNLKLILGLVW
RIIQRFQLSGGGGPGVTQNGSMDGTAPPQQKSAPKVPPKKLMLKWINSVLPEDAGVVKNF
SSDWNNGIILSAILNYCDPSLMTNWHELDKSNGLENCREAMKIANEKYSIPMVVSPEDLS
SKHMDELSGMTYLSYFLKHEGPGWYATLNWVRKNVPEEDVQNFKSDWNDGLALCGLVNAV
GGDFSDCSDWKDMDRDDKINNCHKDV
Download sequence
Identical sequences 7668.XP_792258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]