SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_795534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_795534
Domain Number 1 Region: 116-168
Classification Level Classification E-value
Superfamily RING/U-box 4.71e-18
Family ZZ domain 0.008
Further Details:      
 
Domain Number 2 Region: 357-405
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000219
Family UBA domain 0.0041
Further Details:      
 
Domain Number 3 Region: 16-89
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000932
Family PB1 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_795534
Sequence length 414
Comment (Strongylocentrotus purpuratus)
Sequence
MSMTVKAYLKRGENANAEIRRFVIDVAVSSNYEYLSKKVAQVFPSLGDPDYFSLSWKDSE
GDNITFSSDDELVEALGQINDDTFRIYVKEKKRCRREIRDAPSPGTSTDDGAGQEEQAYH
PGVICDGCESRIRGPRFKCITCPDYDLCKQCESRGIHPDHSFVKFRKPQVGRSHHGGFFN
RPGMFRPFGHPGWRHWWRHQQQQQQQGAGIDVDIDIDNQGNRTHCAGEPNFCGGGGGGHG
RGKHGRRHGGKGHRGCRKTWAGCEQGSSMDVGQEAEPAPSGAARSQEKSGEAGGNTQNKE
QDATQKQPEGTAEPMETTVKDGSAAAPNQSPSGSDDADWTLLENAGGKPSAPSQNPQEDP
SYQYQTALNQMGAMGFDNEGGWLTSLLDAKGGDIVRVLDAIKIGNQPSFSGNSK
Download sequence
Identical sequences W4XUZ7
7668.XP_795534 SPU_007251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]