SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_798773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_798773
Domain Number 1 Region: 131-229
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-27
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 11-106
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-16
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0042
Further Details:      
 
Domain Number 3 Region: 230-404,796-984
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000279
Family HEAT repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_798773
Sequence length 1811
Comment (Strongylocentrotus purpuratus)
Sequence
MLVNPCDISGQPLGLESGALPDSAFSESSCSVASYCSRFGRLNSETGWIADGSDQKPWIQ
KFTGNYDRGIHVTHTLARPVVGRSFRIYPKTKYNQFGLRMELYGYGPLTDAIASLNLDAE
FGCNPPFLGKGLGVEDGRIPDSSLTSSSIYGSGYETYRGRLNNVTGAWAPAYKDKNKWIK
VDLGEDTSVTGVITQGEPTANYMVTSFQISYSRDDKNWAFALEEHCGVRKIRGAMYSLLG
TLCKVMPSILTPYLPKLCPALLASMDETEPLTVGPLWEGILRLISCDLHVNMRKAVLPKL
WSVLRNGGNGCASTIYPHLLPLLSHLPPEVKSQDEAFCREFFNNFREGLSCKRVSQSISE
NTAILKSFMECLRYSIAQSLSSENASVHTHLLDQQLMPLLKSSLTEEGKTWSVVTLYQQT
GALLNYLYKQKVGDEKGSPARQVLETLWSGISAMCVDHVTSALTNQEAGLNNTALLVAVL
KNPNAVEVKKMGASKRRIKGARIRFAVEEEEGGGEIEKQEPSGSNGDDRLGKPQTNNGQS
KIEGVESSTEPSIQHPQLPSLVSDLVQSSFHQARDSLPHLHFLAQLVRTFSDRTTIRTML
KAADVNAACPTRTGSDLICIDAASKVDGEDEDAIRTSGDVKNIQDSEKVAGGSGIDKLDA
RVEKKEEEEKEEDIGSDDDLLPLKCIYSFLLPWLLDVEKDRDARKQEKVLRMEAILDMTV
SVLLTVQEENRILVVDAVCLKAETLQLLHLTISKMRDKPELSSTMDTWLQSELFGEKLLS
IQDELCRLTLEGQLEQSSVGWKLISLALSSGKHDEPLIGTTYAELLLVGFYHALTRPDAV
TTATQCISFICDVTSNFFSAVKGCIHLSSSTDLLLAIFQLECRDAQNLSGSLKEKVRQTW
AQGVQSLVKQTGGLLTDQGLLVKTTQWIKQTLNEKEGNIHQFEQLGLTASAFLAAILDGL
PGNHDDSDQDVMKTLLESLLPSENEWGSHRLELANQWISSAVIGQQMTQCDPPPLTPTDT
THAPQALKLALFVSTLTSDLNKKVQTIGASSGEEHGQEDGEEGEVISMETSGLPWECDAL
QSAIVEVMYMREWCQAITGIEAAPLKLAAGTAVITSPPDYCLQFPQTFSQATEDIWGHLT
PPLWQELFGIVLDRSLKSGGLWSYVLDRFIDINFKHNDEKARINIWQPIDSPNEPWLEIC
SVEMLQTVERLVPHFSDRQCQDLAGCHAGMLVSCEGDWITSLCGGLTNLTVLVRCITMNR
PGPGALPDLALSTLRQLQHWREKSNSVFLFSGEELEGASSEQLCLNIKMVQLVTCVVEKI
PEELESHDWDFILCSLVSWVQACSDNMASIKSSSILASTLCAATSDLLSSTSRLFGQSER
SVKLPSSLLTEWNEFFSDGAYSVFLPAFMRFIEEESLWSAAGVDLTPLLYALCEAAAYTP
TEQLKGHCLPPKLQPGSTRHVPDPLHSLLNHLVALLTKPYRPVQTAAFNMLQRVMPEFAR
YDEEYLQVKNKTQADDEDEAPSILPPTGLQKLLDSSTAFMEALLHDIPVGECTVVETGSE
AYMQTCSYLLAWRLYLTIFRAASMEVRAQYSSYLKQTKGIHSLLESLFCLMPEDPTLERS
ATPSKGSQVTMFSKHPDLSPKAASHVEVNEVQHLACSVYFSILQDVPAIARQWWTLQDRK
IAPYVDRFTTKYISPLLCAEEMRSVQENPSTAENMTVKARLSTREVIATYSMQELNIEMM
ITLPANHPLGPIEVDNRRKVAVGTSQWRQWTLMLTTFLTHQMEHIGNAVIDEFGMWGEMK
VNGLTLNDVVS
Download sequence
Identical sequences 7668.XP_798773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]