SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000004377 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000004377
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000829
Family APC10-like 0.021
Further Details:      
 
Domain Number 2 Region: 374-392,435-646
Classification Level Classification E-value
Superfamily ARM repeat 0.000000785
Family PBS lyase HEAT-like repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000004377
Sequence length 873
Comment (Ciona intestinalis)
Sequence
MPSKIGYSVVGSTGEAEGYGAKNLEHQNPTIPGWQTPRFCVYPQELIIRMNERTNVKKLQ
LLAHQFMIPSKIEFFVGTNESADSFKRLGYIYLSNNEKTGFKARELKSVHVDADGHFLRL
VVHKNHMNKFNLYNQVGIMAFNVIGDGISKRHPLKPISSGTTNPLNYSIEGSINKPDYIS
PMDDLAFDMYQDPEVAGIIRKLDIKKQKAVIAENFDVAKRMKQAIADLQKVGEKLARYEL
DKRRAVEHEDYDLAKSKKSQMDEYRLKVYQQLQKYNLLEDAGISPVKQNGEQPLQQVQEP
QPSPRRVISEPIVSPRPQPSPPPMESPSLFVPHEEIASPRLEPPQEQIQEKVASPEPVAT
YSPRVRHSPAIYDEKVIPALVKHKDPDPFLEDEVPSPRQEFSPDKPSAPSGEPEAMSEKS
IREASSVIDVFGLPLVSGAYSKTWSFREDALLAVYKLLSNAPETISKDELKSHLRAAIFL
IRRAIKDKVHAVFHASLRLLELILVDFVPKHKLGKVETVHAVSRTLPNLIQKTGETAARS
RNAAIEFIDRMSEFAMVHQYQLVAQQATPPFKRDMAMRLALSRVEILERLFTKFGLEPPV
LTVETGMKFASQALSHSSGSVRDAATRIIFLLYKIAGNAVKAYLPPDDNTTRKNPLYRNI
FDGFDRISGKLTQSELKAQQQAKAAESERKKKQEIEDLQSQVNQLRQMNNMVANEVQQPA
VGKKSKKSTTKPPPPPAEEASPNKAGDENDSTYLENMCIFCGERDDAFTEEGLDLHYWKH
CPLLKKCEHCKQVVEVAGYCGHLLTECDKKSEFGECPRCKEAIPLTDLDKHVADKRCTAA
KPGLDHCPLCHKNIALGEESWKSHLMGVKRDAC
Download sequence
Identical sequences 7719.ENSCINP00000004377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]