SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000011347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000011347
Domain Number 1 Region: 81-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 39-79
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000209
Family Somatomedin B domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000011347
Sequence length 261
Comment (Ciona intestinalis)
Sequence
MYRTYAFAAVCSVCMIITLISDAEAGCEDIGRCCSGKSTGCKYSYGSSGRHGRVCYCDEY
CQKSGDCCSDYESYCLSRAQDCVMTYWSHWSHCTARCGLGMTERRREVHIPPSGGGKECG
KRRQTKACRHNNDRCRNKEIAQILPSYHNRKRNVRDKYERPSVLKKVKKDSYCVHYRISS
IAWYCRYASPYHVLKIGSLVCAECHDTAMDREGHCAGSYTAVRSRWRSLVGRPCHGTWES
EGEKEENCRCGENPGKDFIFV
Download sequence
Identical sequences A0A1W2WFZ0
XP_002128452.1.78797 7719.ENSCINP00000011347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]