SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000014695 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000014695
Domain Number 1 Region: 405-678
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-68
Family Eukaryotic proteases 0.00069
Further Details:      
 
Domain Number 2 Region: 195-320
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-24
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000014695
Sequence length 685
Comment (Ciona intestinalis)
Sequence
MNWVFSLFGVLGCLAVAHCSNIRVELANSAPRRVVFFPLAGNTNFSKLQNYLETEWSANR
QVGKNLHLPESTIDALRAYADGDVTSASDPEFPNYLKVAELAPSLADVILGSNSQRPVVP
RQNITCSFQVTYTCTRRVLERYTAICLWRLCDRYRYVNRLTQCTRTQQRCCTGYNLGASG
YCEREAQSQTTDSGCGNPRRLVQRNGILQSPGYPSIDYEANLNCRWSINVPLGYKAILKV
LDLDMENGNGVCNLEAGTCYQQCSFDHLRIFGTRPNTTKILCGNLAPFTEYESVGNSVEI
AFTTDDSVYGRGFKIVYSVVPVSALRSTACPNGQVWQKCRRKCALTCQNNSLRPSNSIWR
NCIDSTGRTSVVSSTRIDDIICTPGCTCPSSRPVLYGNRCEKIEFCPNTLFQCGKSIPRP
SPKIIGGRWAGPGEYPWMVQITTNDEHAVCGATLICSNWVVTAAHCFLKKRGTLVMPNPI
DKLQYLIHVGKYWKYGQQDRRRVQTYRASRIIIHPQYNHRNDREDIALIELDGYVADMTH
ARPICLPSALGRHLSSEYIFNRTNGYPNVGDTCKALGWGITRNIGPSATILKELDMVVAA
GSGCASYHDYNWRKILCAGGEAGRDTCKGDSGGPFLCITNSRWYIHGITSFGHGCARGVP
GGYTRVSNYINWIRLHIGQLCGVVR
Download sequence
Identical sequences A0A1W2WFN0
7719.ENSCINP00000014695 XP_002130348.1.78797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]