SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI117230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI117230
Domain Number 1 Region: 104-159
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 498-542
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000286
Family UBA domain 0.0022
Further Details:      
 
Domain Number 3 Region: 34-94
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000449
Family PB1 domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI117230
Sequence length 554
Comment (Branchiostoma floridae)
Sequence
MSLTVKAYLERSGGSADQPAQEIRRFAMDPDVSSNYDYLSRKVAQVFPSLSDPGDFKLFW
KDGEGDLVSFSSDEELLEALGFVNDGIFRIYVKVSGGGPSQPDGIFHPNVVCDGCNGPVM
GSRFKCTVCPDFDLCGNCEGVGLHPEHELLRMRNPTAPGHPPFCGGMFGPPPPPGCPPGH
PHGGPPHFPGQQGYGPGGPGWFMPRRWWRHWARGMFGANAQRGRRRCHDEEADPETEAAE
EAKQAPADGEQPQESTNQEAGAQEDGTQESGGAAGPREDGGEAPPAFDYLQHVGQAVASM
LDPLGIDVDIDVEHQGQRRKCPRRWAEFEGAWGQQGPECGPWNWPGGKGGRCGRKGMKKA
MKMQKKMQKKQGKMSAEGKGAEEEEEREVPVTMETQEGPQAEKQAEQEVMEVTKDDSSSS
DADGWTHLSPKEGEFTNDHETGEGADAAKQKRKAKEQETVVTAQPPAAGTAGTGGAPVTT
QPSPSRPTAPPPVTAAAEFDKQLAEAIAQMEAMGFRDDNGWLSSLLVAKNYDIAQVLDSL
YPTGRKPDSLPPYV
Download sequence
Identical sequences C3XXF8
XP_002611408.1.56174 7739.JGI117230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]