SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI120319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI120319
Domain Number 1 Region: 104-159
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-17
Family ZZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 504-548
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000296
Family UBA domain 0.002
Further Details:      
 
Domain Number 3 Region: 34-94
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000505
Family PB1 domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI120319
Sequence length 560
Comment (Branchiostoma floridae)
Sequence
MSLTVKAYLERSGGSADQPAQEIRRFAMDPDVSSNYDYLSRKVAQVFPSLSDPGDFKLFW
KDGEGDLVSFSSDEELLEALGFVNDGIFRIFVKVSGGGPSQPDGIFHPNVVCDGCNGPVM
GSRFKCTVCPDFDLCGTCEGLGLHPEHELLRMRNPTAPGHPPFCGGMFGPPPPPGCPPGH
PPPPGHPHGGPPHFPGQQGYGPGGPGWFMPRRWWRHWARGMFGANAQRGRRRCHDEEGDP
ETEAAEEAKQAPADGEQPQESTNQEAGAQEDGTQEASGAAGPREDGGEAPPAFDYLQHVG
QAVASMLDPLGIDVDIDVEHQGQRRKCPRRWAEFEGAWGQQGPECGPWNWPGGKGGRCGR
KGMKKAMKMQKKMQKKQGKMSAEGKGAEEEEEREVPVTMETQEGPQAEKQAEQEVMEVTK
DDSSSSDPDGWTHLSPKEGEFTNDHETGEGAEAAKQKRKAKEQETVVTAQPPAAGTAGTG
GAPVTTQPSPSRPTAPPPVTAAAEFDKQLAEAIAQMEAMGFRDDNGWLSSLLVAKNYDIA
QVLDSIYPTGRKPDSLPPYV
Download sequence
Identical sequences 7739.JGI120319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]