SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI144133 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI144133
Domain Number 1 Region: 562-590,662-721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000466
Family Nucleotide and nucleoside kinases 0.0069
Further Details:      
 
Weak hits

Sequence:  7739.JGI144133
Domain Number - Region: 3-64
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00578
Family Calponin-homology domain, CH-domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI144133
Sequence length 725
Comment (Branchiostoma floridae)
Sequence
MTEILCRWLNDEVKLSKPVDNKTFSKDFSNGYLIGELLARYQLQNDFDKFSQNRTAESKL
NNFTRLEPTLRLLEVDFDTNIAHSIMTEQHGVATRLLYQLFIGLGRKQKANLTGVAMETM
RPAAPVKLEGIESEIYKERLKILTPRQTDQNLGKLQARFDDKWARHEQTMFREKMEEEQR
YRRLQSEESQKAVEKARMARQKQTELLAKLRAATVEIPKPPPSKTLKAIKQRKEARRFKE
AEVRHDLNFLFIHVGNASSPLSAGGAQLFIGVTFPGANDDYIGKIKRRLEEDSKAREERE
KRRRKVLVDQLKAHDAQEEAHREEMLVNRLMRQSQQERRIAVQLLQARHEKDIIRKNRIF
LEKQYDARRVKDFEDALNKEKELAQLAKLEYIEQTKAEQELHDRIAAERAEQRYRKHYDM
CMEVTLQIVDYATKFGEYRELTEKLVYLVQSCERLIYTKSSTFLCCTQDPTAEGSEPTPE
QIIEMEKQKLLNDGDFKEYKEMMGEWEPPDGSEINNEKNNNVVGHIVQRIFNIVSPPKPP
PPPPEFPPFPVRACAVGKLFGGKSSALRILAESHRLAVLSPDQLVTEAVEAFKNGETMSR
KEDSVSLEMKVSNYSRSHSLLLLSSEADKLPLSGSATPLGESGGLSPRSSVRKSSARKSD
SSHPELGSKAIKSLRRGKSVDDQILVDIVIDAIRRLPEGTGWVLDGFPMTLQQGKLLEKA
LTGAE
Download sequence
Identical sequences 7739.JGI144133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]