SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI154496 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI154496
Domain Number 1 Region: 193-426
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-84
Family SSRP1-like 0.00000275
Further Details:      
 
Domain Number 2 Region: 533-616
Classification Level Classification E-value
Superfamily HMG-box 2.09e-26
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI154496
Sequence length 710
Comment (Branchiostoma floridae)
Sequence
DTLEFDQIYQENKGAMYDGRLRISKQGIVFKNNKTGKVDNLSGTDLNLTHWFRVARGYEL
KVGLKSGAVFKYDGFKESDFDKLSDFINKNYKMRLEEKELSVKGWNWGTAKFKGPLLSFD
IDNMSAFEIPLGNVSHCATSKNEVALEFHQNDDADVSLMEMRFYVPPNQDNPDVDPVQAF
HDNVMDKADIIQATGDAICIFKELQCLTPRGRYDVRIYPTFLHLHGKTFDYKLPYTTVLR
LFLLPHKDQRQMFFVVSLDPPIKQGQTRYHFLILQFSKEEDMTLELSLSEEDCADKFEGK
LQKEMSGPVYEIVSRVMKSMVNRKITVPGSFKGNSGTSAVSCSHKAGAGFLYPLERGFIY
VHKPPIHLRFDEISCVNFARGVASNRTFDFEIETKSGTTYTFSSIEKEEYGKLFDFTTNK
KLRVKNRGKNLKDSVNYDEDMMGSDDEGQHDAYMERVKAEAAEGISDDDESSDDEEEDAD
FNPDGSGSDLAEEYDSNASISSSDEDEEDEEKKERRKKKLEKAKSKPAKRRRTSKRKKRQ
KKDPNAPKKAMTAFMLWLNATRSELRKENPDASIGEIGKIAGEKWREMGPSDKEEWEQKA
KEDKERYKAAMEEYQARKEEEGSSEGEESDQAEKKTKKSKSSRPKPSPTKSPSKAGAGAN
YKSKEYITSDSDSDDSDSDRKKAKKSEDEEEEPIASTPPESEESAGDDDD
Download sequence
Identical sequences C3Z3Y2
7739.JGI154496 XP_002596583.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]