SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI198676 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI198676
Domain Number 1 Region: 5-345
Classification Level Classification E-value
Superfamily L domain-like 4.14e-66
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 2 Region: 824-921
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-27
Family PDZ domain 0.0036
Further Details:      
 
Domain Number 3 Region: 674-771
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-23
Family PDZ domain 0.00053
Further Details:      
 
Domain Number 4 Region: 537-641
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-22
Family PDZ domain 0.00024
Further Details:      
 
Domain Number 5 Region: 920-1018
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-21
Family PDZ domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI198676
Sequence length 1065
Comment (Branchiostoma floridae)
Sequence
MFFSPQPFFRLMNLRKLSISDNELLRLPGEISNFMSLMELDCSRNDLPDIPENIKFCKSL
SVVDFSGNPIAKLPDGFTQLRGLRYVALNDISLHKLPGDIGSLSNLITLELRENLLKVLP
TSLSFLVKLEQLDLGANELEDLPETLGALPNLKELWLDGNEIKELPPEIGHLKKLSCLDV
SENKLEFLPDEIGGLVSLTDLHLSQNCLEALPDTIGKLKQLAMLKVDQNRILVLTPDIGS
CERIRELILTENLLQEIPPTIGNLKEMINFNVDRNRLLNVPDEIGGCVKLGVLSLRDNRL
TRLPNELGNLKELHVMDVAGNRLENLPFSITALNLKAVWLSENQSQPMVKFQAEDDEKTG
DKVLTCFLLPQQGPSASMENLFPDGRSMEDAWNEPVPDRTSKVLFDAPEENEEDKPVSDF
TTFVRHNTPHPRELKTRHPKYLAKQQNKHSDEDGHVMTAESEEENEVTVIRHDRERQVTF
SSDTEDMEKNDSKLQRRDTPHHLKRLNLDEETAADAVAAILQRHQSQTSQKGIVLNSVSY
TISVRGLHRKSLMTLTIQRPPGMGLGVSIAGGRGSTPYKGDDEGIFISRVSEDGPAGKAG
VKVGDKLLGVNNVHLEEAEHHEAVDCLRNSGNTVQVVVMREVMEVPQPRPPSPPSMPDEP
PTEVKKHGVSFASGPEVDIPLETIATTLVRDQRGLGFSIAGGKGSTPYKGNDTGVFISRI
AEDGIAEADGKLDVGDKIISINGTDVTEARHDQAVSLLTSSDRIQLVIYREHLVINQDPP
ASTTPKARPPTPPPLMSSPGPLVEPPSPIVNHAEEEEEMKDSPYPVEEVTLVREGGPLGL
SIVGGSDHCSHPFGMDEPGIFISKVKPGGAADKTSLKVGDRILKVNGMDLRHATHQEAVQ
ALLSNTHQIDMVVRHDPPPRELQEINLIKAPGEKLGISIRGGVRGHPGNPLDKSDEGIFI
SKVSQVGAAARDARLKVGMRILEVNNQSLLGCTHVEAVRALRAVGDRLQVLVCYGYDEEA
VKSMSPTSIIANPMLIGDGIRRGSQDSISSIDRDLSSDEMSIVRQ
Download sequence
Identical sequences C3YMW6
XP_002602445.1.56174 7739.JGI198676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]